KEGG   Mesorhizobium sp. B7: BSQ44_05215Help
Entry
BSQ44_05215       CDS       T04603                                 

Definition
(GenBank) D-alanine:D-lactate ligase-like protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
meso  Mesorhizobium sp. B7
Pathway
meso00473  D-Alanine metabolism
meso00550  Peptidoglycan biosynthesis
meso01100  Metabolic pathways
meso01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:meso00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BSQ44_05215
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSQ44_05215
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BSQ44_05215
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:meso01011]
    BSQ44_05215
Enzymes [BR:meso01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BSQ44_05215
Peptidoglycan biosynthesis and degradation proteins [BR:meso01011]
 Precursor biosynthesis
  Amino acid ligase
   BSQ44_05215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C
Motif
Other DBs
NCBI-ProteinID: APH70845
UniProt: A0A1L3SND5
LinkDB All DBs
Position
complement(1041445..1042539)
Genome map
AA seq 364 aa AA seqDB search
MASRPNLILVYEPEAACRTRLAEEGFPPERVVEISSYLAQSTDIAADFAAISAACERRGI
DFLPVELDDAAQALAGRDPASTLVWTLTDGIAYFRGSAAPALARLHGLKTFGSDDTLFAL
CQDKFRSGAVLAALGMPVPAAGLARAGEWIVPPPNSATGYFVKPNRLGAKIGIWADSRCD
SRDEALAISRRISEHFRDDAIVQPYVAGRNVRASFLAVDPAADGRALGVALVDSGGDFQT
MSDSMALYGETGDAAQAAGSRVEPMLEPLVRRQPGADAKIRRIGAMLMGSLGLRDVFSAD
FRVEADDTVHLLEFEVCPGLPCFDFRGYCRRQWDLSLAEAMAEAAARRLCGAEPQPTLAM
QTGV
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtggcatccagaccgaacctgatcctggtttacgagcccgaggcggcatgccggacgcgg
cttgcagaagaaggctttccgcccgagcgggtcgtcgagatcagttcgtacctcgcgcag
tcgacggacatcgcagccgatttcgctgccatctcggccgcgtgcgaacggcgcgggatc
gacttcctgccggtggaactggacgatgccgcgcaggctctcgcgggccgcgatccggcc
tcgacgctcgtctggacgctgacggacggcatcgcctatttccgaggttcggccgccccg
gcgctggcgcggctgcatgggctgaaaaccttcggctcggacgacacgctgtttgcgctg
tgccaggacaagttccgctcgggcgccgtcctcgccgcactgggaatgccggttccggct
gccggccttgcgcgtgcgggcgaatggatcgtgccgccgccaaactctgcgacgggctac
ttcgtcaagcctaaccggctcggcgccaagatcggcatctgggcggattcgcggtgcgac
agtcgggacgaggcgctggcgatcagccgccgtatctccgagcattttcgcgacgatgcg
atcgtccagccttatgtcgcggggcgcaacgtgcgcgcgagttttcttgccgtggatccg
gcggcggacgggcgagcacttggcgtggctctcgtcgattccggcggcgacttccagacg
atgtcggacagcatggcgctctacggcgagacgggagacgccgcgcaggccgcaggcagc
cgcgtcgagccgatgctggagccgcttgtccgcagacaaccgggggcggatgcgaaaatc
cgccggatcggcgcgatgctcatgggcagcctggggctgcgggacgtcttttcggcggat
ttccgggtcgaggcggacgacaccgtccacctcttggagttcgaggtctgcccgggcctg
ccgtgcttcgactttcgcggctactgccggcgacagtgggacctgtcgcttgccgaagcc
atggccgaagccgccgcgcgccggctctgcggcgccgagcctcagccgaccttggccatg
cagaccggcgtgtga

DBGET integrated database retrieval system