KEGG   Mesorhizobium sp. B7: BSQ44_07685Help
Entry
BSQ44_07685       CDS       T04603                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
meso  Mesorhizobium sp. B7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh PI31_Prot_C
Motif
Other DBs
NCBI-ProteinID: APH71270
UniProt: A0A1L3SPG8
LinkDB All DBs
Position
1535838..1537304
Genome map
AA seq 488 aa AA seqDB search
MNVMHRPVAGPKAPERFFIGGRWIDPISRQTLKVVSPTTEELLMTYPEAGPADIDRAVSA
ARDAFDNGPWPRMSPSERAGYLRRVAGLLSERLEDIAQAWTVQVGAPISLTRKLVGQNPT
LFNYYADLIETYPFVDDRTRDDGGKVKVVKEPVGVCAAITPWNAPLVLLSYKVSAALAAG
CTMVAKPSPETPLEAYILAECIEKAGLPAGVFNIVPAGREGGDYLVRHKGIDKVAFTGST
GAGKHIAAVCAERLARVSLELGGKSAAVLLDDADFQAALPSLMVYTMPITGQVCFSLTRV
LVPERREKEFLDLYLGAVSNIKVGDPMDPSTQMGPLTMARQRQRVEGYIAAGRAEGARIA
CGGGRPKGLDRGYYVEPTVFTGVTPHMKIVQEEIFGPVVSVMTYRDEDEAVAKANNSQYG
LSGAVYTADPQRGYEMARKMRTGSITINGMIVDPKHPFGGFKQSGMGREGGPEGLDNYVE
TKTIHFAG
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgatgcacagacccgtcgcgggcccgaaggcgcccgagcgcttcttcatcggc
ggacgctggatcgacccgatctccaggcagacgctcaaggtggtctccccgactaccgag
gaactgctcatgacctatcccgaagcggggccggcggacatcgaccgcgcggtgtcggcg
gcgcgcgacgctttcgacaacggaccctggccgcgcatgtcgccgtccgaacgtgccggc
taccttcgccgtgtggccgggctcctgtctgagcggctggaggacatcgcgcaggcctgg
accgtccaggtcggcgcgccgatctcgctgacccggaagctggtcgggcagaacccgacg
ctcttcaactactatgcggacctgatcgagacctaccccttcgtcgacgaccgcacccgc
gacgacggcggcaaggtcaaggtggtgaaggagccggtaggcgtctgcgccgcgatcacg
ccgtggaacgcgccactggtgctcctgagctacaaggtttcggccgcccttgcggcgggc
tgcaccatggtggcgaagccgtcgccggaaacgccgctcgaggcctacatactggccgaa
tgcatcgagaaggcggggctgcccgcgggcgtcttcaacatcgtgccggcggggcgcgag
ggcggcgactacctcgtgcgccacaagggcatcgacaaggtcgccttcaccggctcgacg
ggggcaggcaagcacatcgccgcggtctgcgccgaacggctcgcccgcgtcagcctcgaa
ctcggcggcaagtcggccgcggtgctgctggacgacgcggatttccaggcggcactgccg
agcctcatggtctacaccatgccgatcaccggccaggtctgcttctcgctgacgagggtg
ctggtgccggaacggcgcgagaaggagttcctcgacctctacctgggcgccgtctcgaac
atcaaggtcggcgatcccatggatccgtcgacccagatgggaccgctgaccatggcaaga
cagcgccagcgcgtggaaggctacatcgccgccggacgtgccgagggcgcccgcatcgcc
tgcggcggcggccggcccaaggggctcgaccgcggctactatgtcgagccgacggtcttc
accggcgtcacgccccacatgaagatcgtccaggaggagattttcgggccggtcgtgtcg
gtcatgacctaccgcgacgaggacgaggcggtcgccaaggccaacaactcgcagtacggc
ctgagcggcgcggtctacaccgccgatccgcagcgcggctacgaaatggcgcgcaagatg
cgaaccggcagcatcacgatcaacggcatgatcgtcgatcccaagcaccccttcggcggc
ttcaagcagtccggaatgggccgcgagggcggaccggaaggcctcgacaactacgtcgag
accaagaccatccactttgccggatga

DBGET integrated database retrieval system