KEGG   Mesorhizobium sp. B7: BSQ44_13110Help
Entry
BSQ44_13110       CDS       T04603                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
meso  Mesorhizobium sp. B7
Pathway
meso00564  Glycerophospholipid metabolism
meso01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:meso00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSQ44_13110
Enzymes [BR:meso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BSQ44_13110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 Pyr_redox_2 FAD_oxidored Lycopene_cycl NAD_binding_8 K_oxygenase Pyr_redox GIDA
Motif
Other DBs
NCBI-ProteinID: APH72199
UniProt: A0A1L3SS17
LinkDB All DBs
Position
2665268..2666797
Genome map
AA seq 509 aa AA seqDB search
MDAAGIYDILVIGGGINGCGIARDAAGRGYSVFLAEMNDLASGTSSWSTKLIHGGLRYLE
HYEFRLVREALMEREVLWSNAPHIIWPMRFVLPHHKGLRPAWLLRLGLFLYDHIGGRKLL
PATKTLDMRRDPAGKPLKPLFSRAFEYSDCWVNDARLVVLNARDAANRGAVIRTRSRVAS
AQRTGEHWQAVVENRSTGEKETVRARLIVNAAGPWVDEVLASSLGRNDVHNVRLVQGSHI
VVPRKFDDPRAYFFQNRDGRIIFAIPYEEDYTLIGTTDRDYEGEPGDVAISDAEIDYLCE
AASEYFADPVSREDIVWTYSGVRPLFDDGASKAQEATRDYVLRSEGGEDKAPLLNIFGGK
ITTYRRLAEAMLEKIEGFLGSKGKPWTMGAPLPGGDFPATGFEEQVSRFRADHPFLEAAH
ARRLVRLYGTRADQVVGLASSTTELGRHFGADLYEAEVRYLMANEWAVTADDVLWRRTKR
GLRLGGEETAALEEFMRGAASREDKAAAE
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
gtggacgccgcggggatatacgacatccttgtcatcggaggcggtatcaacggttgcggc
atcgcccgcgatgccgcgggccgcggctactccgtcttcctcgccgagatgaacgatctg
gcgagcggcacgtcctcttggtccaccaagctgatccatggcggcctgcgctatcttgag
cactacgagtttcggctggtgcgtgaggcgctcatggagcgcgaggtgctgtggagcaac
gccccgcacatcatctggccgatgcgcttcgtgctgccccatcacaaggggctgcgcccg
gcctggctgctgcggctcggactgttcctctatgaccacatcggagggcgcaagctgctg
ccggccacgaagacgctggacatgcggcgcgatcccgcgggcaagccgctgaagcccctt
ttctcgcgcgctttcgaatattccgactgctgggtcaacgatgctcgcctcgttgtgctg
aacgcccgcgatgcggccaatcgtggcgccgtcatccgcacgcgctcccgcgtcgcgtcg
gcgcagcgcaccggcgagcactggcaggcggtggtcgagaaccgctccactggcgagaag
gaaaccgttcgggcgaggctcattgtcaacgccgccggcccatgggtcgacgaggtgctg
gcctcctcgctcggccgcaacgacgtccacaacgtccggctcgtgcagggcagccacatc
gtcgttccccgcaaattcgacgatccgcgcgcctatttcttccagaaccgcgacggacgc
atcatcttcgcgatcccctacgaggaggattacactctcatcggcacgacggaccgcgac
tacgagggcgagccaggcgacgttgcgatcagcgatgccgagatcgactacctctgcgag
gccgccagcgaatacttcgcagacccggtgagtcgcgaagacatcgtgtggacctattcg
ggcgtgcggccgctgttcgacgacggcgcttccaaggcgcaggaggcgacgcgcgattac
gtgcttcgttccgaaggcggtgaggacaaggcgccgctgctcaacatcttcggcggcaag
atcacgacctataggcgcctcgccgaggcgatgctggagaagatcgaggggttcctcggc
tccaagggcaagccgtggactatgggcgcgccgcttcccggcggtgattttccggcgaca
ggcttcgaggagcaggtgtcgcgcttccgcgccgatcatcccttcctggaggctgcgcat
gcgcgcaggctcgtgcgtctctatggcaccagggcggatcaggtcgtcggtctcgcctcg
tcgaccaccgagctcggccggcacttcggcgccgatctctacgaggcggaggtccgatac
ttgatggcgaacgaatgggcagtcactgcagacgacgtattgtggcggcgcacaaagagg
ggactgaggctcggcggggaggagaccgctgcgctcgaggaattcatgcgcggcgccgcc
agccgcgaggacaaggcggccgcagaatag

DBGET integrated database retrieval system