KEGG   Mesorhizobium sp. B7: BSQ44_15310Help
Entry
BSQ44_15310       CDS       T04603                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
meso  Mesorhizobium sp. B7
Pathway
meso00010  Glycolysis / Gluconeogenesis
meso00020  Citrate cycle (TCA cycle)
meso00620  Pyruvate metabolism
meso01100  Metabolic pathways
meso01110  Biosynthesis of secondary metabolites
meso01120  Microbial metabolism in diverse environments
meso01130  Biosynthesis of antibiotics
meso01200  Carbon metabolism
Module
meso_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:meso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSQ44_15310
   00020 Citrate cycle (TCA cycle)
    BSQ44_15310
   00620 Pyruvate metabolism
    BSQ44_15310
Enzymes [BR:meso01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BSQ44_15310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Spore_IV_A
Motif
Other DBs
NCBI-ProteinID: APH72572
UniProt: A0A1L3STD6
LinkDB All DBs
Position
complement(3134796..3136235)
Genome map
AA seq 479 aa AA seqDB search
MPINITMPALSPTMEEGNLAKWLVKEGDLVAPGDVIAEIETDKATMEVEAVDEGTVAKIV
VPAGTEGVKVNALIAVLAEEGEDVSEAAKGGGDGAAPKAEKKAEKAEGKPEKAEAPSAPP
AAKPAEGGGSAAKSEQAASPVSDTASSDRPSKKQGNGADTSRTFASPLARRLAKDAGIDL
SAIEGSGPHGRVVKADVEAASAGGTAKAAPAGKASEEKPAAAAPASAPKTMSDDAVLKLF
EEGSYELVPHDGMRKTIAARLTESHQTVPAYFVSMDCEIDALLKLRAEINAASPMRKTEK
GDVPAYKLSVNDFIIKAMALALRDVPMANASWTSTARVRHRHSDVGVAVAIPDGLITPII
RKAEEKTLSVISNEMKDLAKRARDKKLKPQEYQGGTTAVSNLGMFGVSNFTSIINPPHAS
IVSVGAGVEKPVVKGGEIKVATIMTATFAFDHRVIDGALGAELAAAFQRHIEKPMGMLV
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaacatcaccatgccggccctctcgcccacgatggaggagggcaatctcgcc
aagtggctggtcaaggaaggcgacctggtggcgcccggcgacgtaatcgccgagatcgag
acggacaaggcgaccatggaggtcgaggcggttgacgagggcacggtggccaagatcgtc
gtgccggccgggacggagggcgtgaaggtcaatgcgctgatcgcagtgctggcggaagag
ggtgaggacgtttccgaggccgcgaagggcggcggggacggcgcggcgcccaaagccgaa
aagaaggcagagaaggccgaggggaagccggaaaaggcggaggcgccatccgctcctccc
gcagcgaagcccgcggagggcggcggctccgccgccaagtccgagcaagcggcgtcaccc
gtgtccgacacggcctcatccgaccggccctcgaagaagcagggcaacggcgcggacacc
tcccgcaccttcgcctcgccgctggcgcggcggctggccaaggacgccggcatcgacctg
tcggccatagaagggtccgggccgcacgggcgcgtggtaaaggccgacgtggaggccgcg
tcggccggcggcacggcgaaggcggcgccagcaggcaaggcttcggaggagaagccggcg
gcggccgcccctgcatccgctccgaagaccatgtcggacgacgcggtgctgaagctcttc
gaggagggctcctacgaactcgtgccgcacgacggcatgcgcaagacgatcgcggcgcgg
ctgaccgaatcgcaccagaccgtgccggcctacttcgtctccatggattgcgagatcgac
gcgctgcttaagctgcgcgccgagatcaacgcggcatcgccgatgcgcaagacggaaaag
ggcgacgtgccggcctacaagctctcggtcaacgacttcatcatcaaggcgatggcgctg
gcgctgcgcgacgtgccgatggcgaacgcctcctggacgtcgacggctcgggtccggcac
cggcattccgacgttggcgtcgcggtggcgatccccgacgggcttataacgccgatcatc
cgcaaggcggaggaaaagaccctgtcggtgatttccaacgagatgaaggacctggccaaa
cgggcccgcgacaagaagctgaagccgcaggaataccagggcggcacgacggcggtgtca
aacctcggcatgttcggcgtgtcgaatttcacctccatcatcaacccgccgcacgcctcg
atcgtctcggtcggcgctggcgtggagaagccggtggtgaagggcggcgagatcaaggta
gccaccatcatgaccgcgaccttcgccttcgaccaccgggtgattgacggcgcgctgggc
gcggaactggcggcggcgttccagcggcacatcgagaagccgatggggatgttggtgtga

DBGET integrated database retrieval system