KEGG   Mesorhizobium sp. B7: BSQ44_17320Help
Entry
BSQ44_17320       CDS       T04603                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
meso  Mesorhizobium sp. B7
Pathway
meso00020  Citrate cycle (TCA cycle)
meso00480  Glutathione metabolism
meso01100  Metabolic pathways
meso01110  Biosynthesis of secondary metabolites
meso01120  Microbial metabolism in diverse environments
meso01130  Biosynthesis of antibiotics
meso01200  Carbon metabolism
meso01210  2-Oxocarboxylic acid metabolism
meso01230  Biosynthesis of amino acids
Module
meso_M00009  Citrate cycle (TCA cycle, Krebs cycle)
meso_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:meso00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSQ44_17320
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BSQ44_17320
Enzymes [BR:meso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BSQ44_17320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: APH72928
UniProt: A0A1L3SU59
LinkDB All DBs
Position
3535801..3537012
Genome map
AA seq 403 aa AA seqDB search
MSKIKVDNPVVELDGDEMTRIIWQFIKDKLIHPYLDIDLKYYDLGMEHRDATDDQVTIDA
ANAIAQYGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGTIFREPIIMKNVPRL
VPGWTKPIVVGRHAFGDQYRATDFRFPGKGKLTIKFVGEDGQTIEHEVFDAPGSGVAMAM
YNLDDSIRDFARASLNYGLLRGWPVYLSTKNTILKAYDGRFKDIFQEIYEKEFAADFKAK
KITYEHRLIDDMVAASLKWSGGYIWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDGKT
VEAEAAHGTVTRHYRQHQKGEETSTNPIASIFAWTRGLAHRAKLDDNAALGTFADTLEKV
CIQTVESGFMTKDLALLIGPDQPWLSTTGFLDKIDENLQKAMA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaatcaaggtggacaatcccgtcgtcgaactcgacggcgacgagatgacccgc
atcatctggcagttcatcaaggacaagctgatccacccctatctagacatcgacctcaag
tattacgacctcggcatggagcaccgcgacgccaccgacgaccaggtgacgatcgacgcg
gccaacgccatcgcgcaatacggtgtcggcgtgaaatgcgccacgatcacgcccgacgaa
gcccgcgtcgaggagttcggcctgaagaagatgtggcgctcgcccaacggcacgatccgc
aacatcctgggcggcaccatcttccgcgagccgatcatcatgaagaacgtgccgcgcctc
gtgcccggctggaccaagccgatcgtggtcggccgccacgccttcggcgaccagtaccgc
gccaccgacttccgcttccccggcaagggcaagctgaccatcaagttcgtcggcgaggac
ggccagacgatcgagcacgaggtcttcgatgcgccgggctcgggcgtcgccatggcgatg
tacaatctcgatgattcgatccgcgatttcgcccgcgcctcgctgaactacggcctgctg
cgcggctggccggtctacctgtcgaccaagaacaccatcctcaaggcctatgacgggcgc
ttcaaggacatcttccaggagatctacgagaaggaattcgcggccgatttcaaggctaag
aagatcacctacgagcaccgcctgatcgacgacatggttgcggcgagcctgaaatggtcg
ggcggctacatctgggcctgcaaaaactacgacggcgacgtgcagtccgatacggtcgcg
cagggcttcggctcgctcggcctgatgacctcggtcctgatgacgccggacggcaagacg
gtggaagccgaagccgcgcacggcacggtgacgcgccactatcgccagcaccagaagggc
gaggagacctcgaccaacccgatcgcctcgatcttcgcatggacgcgcggccttgcccat
cgcgccaagctcgacgacaacgccgccctcgggaccttcgcggacacgctggagaaggtg
tgcatccagaccgtggaatcgggcttcatgaccaaggacctggcactgctgatcggcccc
gaccagccctggctgtcgaccaccggcttcctcgacaagatcgacgagaacctccagaag
gcgatggcctga

DBGET integrated database retrieval system