KEGG   Mesorhizobium sp. Pch-S: C1M53_22490Help
Entry
C1M53_22490       CDS       T05918                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mesp  Mesorhizobium sp. Pch-S
Pathway
mesp00473  D-Alanine metabolism
mesp00550  Peptidoglycan biosynthesis
mesp01100  Metabolic pathways
mesp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mesp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C1M53_22490
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C1M53_22490
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    C1M53_22490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mesp01011]
    C1M53_22490
Enzymes [BR:mesp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     C1M53_22490
Peptidoglycan biosynthesis and degradation proteins [BR:mesp01011]
 Precursor biosynthesis
  Amino acid ligase
   C1M53_22490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 GARS_A CPSase_L_D2 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: QAZ47430
UniProt: A0A4P6HIC4
LinkDB All DBs
Position
4794309..4795235
Genome map
AA seq 308 aa AA seqDB search
MKKKHVAVLLGGFSSERPVSLSSGKACADTLEAEGYQVTRVDVGRDVSSVLAELKPDVVF
NALHGPYGEDGTIQGVLEFLGIPYTHSGVLASALAMNKEQAKKVAKTVGIPVAESRVIDR
FTIKNEHPMRPPYVVKPVNEGSSFGVVIVKEDQSHPPQLISSPEWNYGEEVMVERYIHGR
ELTCAVMGDVALGVCEIIPTGHSFYDYDSKYVPGGSKHEVPAKISLNIYQKIQTLALKAH
QAIGCRGVSRSDFRYDDRHSENGEVVWLEINTQPGMTPTSLVPEIAAQAGHSFGELLSWM
VEDASCRR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaaacatgtggccgtcctgctgggaggtttttcgtccgagcggcccgtgtcc
ttgtcttccggaaaggcctgtgccgatacgcttgaggcggaggggtatcaggtcactcgt
gtcgatgtcgggcgtgatgtttcctctgttctggctgagctgaagccggatgtcgttttc
aacgccttgcatggtccttatggcgaggacggtaccatccagggcgtgctcgaattcctt
gggattccctatacgcattccggcgtgctggcctcggcgctcgccatgaacaaagagcag
gccaagaaggtggccaagacggttgggattccggttgctgagtctcgggtcatcgaccgt
ttcaccatcaagaacgagcacccgatgcggccgccctatgtggtgaagcctgtcaacgag
gggtcgagcttcggcgtcgtcatcgtcaaggaggatcagtcacatccgccgcagctgatc
tcgtcgccggagtggaattatggcgaggaggtcatggtcgagcgttacatccatggacgc
gaattgacctgtgctgtgatgggcgatgtggcgctcggtgtctgcgaaatcatcccgacc
ggccattccttctacgattatgattcaaaatacgttccgggtggatcaaaacacgaggtc
cctgctaaaatttcactaaatatttaccaaaaaatacagacactggccctcaaggctcac
caagcgatcggttgccggggcgtctcccggtcggacttccgttacgacgaccgtcattcc
gaaaacggcgaggttgtctggctcgaaatcaacacgcagccgggtatgacgccgacgtct
ttggtgccggagatcgctgcccaggcagggcattcgttcggcgagctgttgagttggatg
gtggaggacgcgtcgtgtcggcgttga

DBGET integrated database retrieval system