KEGG   Mesorhizobium sp. Pch-S: C1M53_25355Help
Entry
C1M53_25355       CDS       T05918                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mesp  Mesorhizobium sp. Pch-S
Pathway
mesp00564  Glycerophospholipid metabolism
mesp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mesp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    C1M53_25355
Enzymes [BR:mesp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     C1M53_25355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 Pyr_redox_2 STPPase_N NAD_binding_8 Mqo
Motif
Other DBs
NCBI-ProteinID: QAZ45749
LinkDB All DBs
Position
5409887..5411416
Genome map
AA seq 509 aa AA seqDB search
MDGTPVHDIFVIGGGINGCGIARDAVGRGYSVFLAEMNDLASGTSSGSTKLIHGGLRYLE
FYEFRLVREALMEREVLWCNAPHIIWPMRFVLPFFAGGPRPAWMLRLGLFLYDHIGGRKL
LPATKTLDMRRDPAGKPLKPLFSKAFEYSDGWVNDARLVVLNARDAADRGATIRTRTKVV
AARREGDLWAITIEDLRDRKTETVRAKLLVNAAGPWVDHVLEKTVGKNDVHNVRLVQGSH
IVVRKKFDDPRAYFFQNKDGRIIFAIPYEEDFTLIGTTDRDYSDDPHNVTISEGEIDYLC
AAASEYFADPVTRADIVWTYSAVRPLYDDGASKAQEATRDYVLKAEGGEGAAPLINAFGG
KITTYRRLAESMLEKIEGFLGKRGDPWTAKGALPGGDFPATGYEAEVTKLKSSYPFLETR
MARRLVRLYGTRARMLLGLAKSTADLGQDFGAHLYEAEVRYLVDHEWARTAEDILWRRTK
RGLHFDREQTAKLEAFLHRISGPHIAAAE
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttggacggaactccggtccatgacatttttgtcatcggcggtggcatcaacggttgcggc
attgcgcgcgacgcggttggccgtggctattccgtattcctggccgagatgaacgatctg
gcgagcgggacgtcatccggctcgaccaagctcatccacggcggcctgcgctatctcgaa
ttctatgaattccgccttgtgcgcgaggcgttgatggagcgcgaggtgttgtggtgcaat
gcgccgcacatcatctggccgatgcgtttcgtactgcccttttttgctggcggtccacgc
ccagcctggatgctgcggcttggtcttttcctctatgatcatatcggcgggcgcaagctc
ctgccggccacgaaaacgctggacatgcggcgcgatcctgccggcaagccgctgaagccg
ctgttttccaaggcgttcgaatattccgacggttgggtcaacgatgcgcgcctggtggtg
ctgaatgcccgtgatgccgccgaccgcggcgcgaccatccgtacccgcaccaaggttgtc
gcagcgcgccgcgagggtgacctgtgggcgattacgatcgaagacctgcgcgaccgcaag
accgaaaccgtcagggcgaagctgctggtcaatgctgccggcccctgggttgatcatgtc
ctggaaaagaccgtcggcaagaacgacgtgcacaatgtgcgtctggtgcagggcagccat
atcgtcgtgcgcaagaagttcgatgacccgcgcgcctacttcttccagaacaaggatggc
cgcatcatcttcgccatcccctatgaggaagacttcacgctgatcggtaccaccgatcgc
gactattccgacgatccgcacaatgtgacgatcagcgaaggcgagatcgactatctgtgc
gccgcggccagcgaatatttcgccgatccggtgacgcgcgccgacatcgtctggacttac
tctgcggttcgcccgctttacgatgacggtgcatccaaggcgcaggaagcgacacgcgac
tatgtgctgaaagccgaaggcggggagggtgcagctccgctcatcaatgcgtttggcggc
aagatcaccacctatcgccgcctggcggagtccatgctggagaagatcgaaggtttcctc
ggcaagcgcggcgatccctggacggcaaaaggcgcgctgcctggcggcgactttcccgca
accggctatgaggccgaggtgacgaagctcaagagctcctatccgtttctggaaacccgc
atggcgaggcgtcttgtgcgactttacggcacgcgcgcgcgcatgctgctcggactggcc
aagtcgacggctgatctcggccaggacttcggtgcccacctctacgaggccgaggtccgc
tatctcgtcgaccatgaatgggcccggaccgccgaggacatcctctggcgcagaaccaag
cgcggactgcatttcgatcgcgaacagactgccaagctggaagcatttctgcaccgcatc
agcggcccgcatatagctgccgccgaatag

DBGET integrated database retrieval system