KEGG   Mesorhizobium sp. Pch-S: C1M53_25755Help
Entry
C1M53_25755       CDS       T05918                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
mesp  Mesorhizobium sp. Pch-S
Pathway
mesp00260  Glycine, serine and threonine metabolism
mesp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mesp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C1M53_25755
Enzymes [BR:mesp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     C1M53_25755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 HI0933_like
Motif
Other DBs
NCBI-ProteinID: QAZ45810
UniProt: A0A4P6HEH3
LinkDB All DBs
Position
5490878..5491912
Genome map
AA seq 344 aa AA seqDB search
MSNMMRALVKAKAEPGIWMERVPVPEIGPNDVLIKVKKSAICGTDVHIYNWDQWAQKTVP
VPMVTGHEFVGTIADVGSAVTEYKVGQRVSGEGHIVCGHCRNCRAGRGHLCRNTLGVGVN
RPGSFGEYVAIPQHNVVPIPDDIPDEIAAIFDPLGNAVHTALSFDLVGEDVLVTGAGPIG
IMGALVAQCVGARKVVITDINPTRLALARKMGVRHVVDASKEKLRDVMHDEGMTEGFDVG
LEMSGSAVAFRDMIDTMNNGGKIAILGIAPTGFEIDWNKVIFKMLHLKGIYGREMFETWY
KMIALVQGPLDVSGLITHRIGIDDYQSGFDAMRSGNSGKVVMDW
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacatgatgcgtgcgctggtgaaggcaaaagccgagcccgggatctggatggag
cgtgtgccggttcccgagatcggccccaacgacgtgctgatcaaggtcaagaagtcggcg
atctgcggcacggacgtccatatctacaactgggaccagtgggcccagaagacggtgcct
gtgccgatggtgacgggacatgaattcgtcggcaccattgccgatgtcggttccgccgtc
accgaatacaaggtcggccagcgcgtatcgggcgaaggccatatcgtctgcggtcattgc
cgcaattgccgggcgggcaggggccatctgtgccgcaacacgcttggcgtcggcgtcaac
cggccgggctcgttcggcgagtatgtcgccatcccgcagcacaatgtcgtgccgatcccg
gatgacattcccgacgaaattgccgcgatcttcgatccgctcggcaatgcagtccatacc
gcgctgtccttcgacctggtcggtgaggacgtgttggtcaccggcgccgggccgatcggc
atcatgggcgcgctggtggcgcaatgtgtcggtgcgcgcaaggtcgtgatcaccgacatc
aacccgacgcgcctggcgctggccaggaagatgggcgtgcgccatgtcgtcgatgcctcg
aaggaaaaattgcgcgatgtcatgcatgacgaaggcatgaccgagggttttgacgtcgga
ctggagatgtcgggctcggccgttgctttccgcgacatgatcgacaccatgaacaatggc
ggcaagatcgccattctcggcatcgcgccgaccggattcgagatcgactggaacaaggtc
atcttcaaaatgctgcatctcaagggcatctacggccgcgagatgttcgagacatggtac
aagatgatcgcgctggtgcagggaccgctcgatgtcagcggactgatcacccatcgtatc
ggcattgacgactatcagtcgggcttcgatgccatgcgcagcggcaattccggcaaggtc
gtgatggattggtag

DBGET integrated database retrieval system