KEGG   Mesorhizobium sp. Pch-S: C1M53_26080Help
Entry
C1M53_26080       CDS       T05918                                 

Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
mesp  Mesorhizobium sp. Pch-S
Pathway
mesp03030  DNA replication
mesp03430  Mismatch repair
mesp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mesp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    C1M53_26080
   03430 Mismatch repair
    C1M53_26080
   03440 Homologous recombination
    C1M53_26080
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mesp03032]
    C1M53_26080
   03400 DNA repair and recombination proteins [BR:mesp03400]
    C1M53_26080
Enzymes [BR:mesp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     C1M53_26080
DNA replication proteins [BR:mesp03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     C1M53_26080
DNA repair and recombination proteins [BR:mesp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     C1M53_26080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: QAZ45865
UniProt: A0A4P6HBP0
LinkDB All DBs
Position
5555008..5555457
Genome map
AA seq 149 aa AA seqDB search
MAEVLFYHMTESTLEQALPGLLERSVDRGWRVVVQTGTEERRDALDQHLWIYSDDGFLAH
ATDREPYPAEQPVLLTTGDMNPNSAQIRFLVDGASPPDLAGYDRAVFLFDGHDAGQVEAA
RSHWKDMKGAGHTVTYWQQTADRRWERKA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagtgctgttctaccatatgacggagtcaacgctcgagcaggcgttgccgggc
ttgctcgagcgcagtgtcgatcgcggctggcgcgtggtcgtgcagacgggcacggaagag
cgcagggatgcacttgaccagcatttgtggatctacagcgacgatggtttcctggcgcat
gcgactgaccgtgagccttatccggctgaacagcctgtgctgcttacgacgggggacatg
aaccccaattcggcgcagattcgcttcctggtggatggtgccagccctccagaccttgcc
ggctatgaccgtgccgttttcctcttcgacggacatgacgcaggtcaggtcgaggcggcg
cgtagccactggaaggacatgaagggcgctggccataccgtaacctattggcagcagacg
gcagaccgtcgctgggaacgcaaggcatga

DBGET integrated database retrieval system