KEGG   Mesorhizobium sp. Pch-S: C1M53_27020Help
Entry
C1M53_27020       CDS       T05918                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
mesp  Mesorhizobium sp. Pch-S
Pathway
mesp00061  Fatty acid biosynthesis
mesp00780  Biotin metabolism
mesp01100  Metabolic pathways
mesp01212  Fatty acid metabolism
Module
mesp_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mesp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    C1M53_27020 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    C1M53_27020 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mesp01004]
    C1M53_27020 (fabZ)
Enzymes [BR:mesp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     C1M53_27020 (fabZ)
Lipid biosynthesis proteins [BR:mesp01004]
 Fatty acid synthase
  Component type
   C1M53_27020 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT
Motif
Other DBs
NCBI-ProteinID: QAZ46032
UniProt: A0A4V0YPV1
LinkDB All DBs
Position
5703475..5703945
Genome map
AA seq 156 aa AA seqDB search
MADTAGSTLEVVDLIGLMKILPHRYPFLMIDRIIDIDGDNSAIGVKNVTVNEPHFMGHFP
EHPVMPGVLILEAMAQTAGAICIRAAGAEKPSLVYLLTIDGAKFRKPVVPGDQLLIHVRK
LKKRGNLLKFACEGKVDGVVVAEAEVQAMMVENERP
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggctgatacggccggttcgacgcttgaagtcgtcgatctgatcgggctgatgaaaatc
ctgccccatcgctatccgttcctgatgatcgaccgcatcatcgatatcgatggcgacaac
tccgccatcggcgtcaagaatgtcacggtcaatgaaccgcacttcatgggccattttccg
gaacatccggtgatgccgggtgtgttgatcctggaggcgatggcacagaccgcgggcgcg
atctgtatccgcgcggcgggtgctgaaaagccgtcacttgtctatctgctgaccattgac
ggcgccaagtttcgcaagcccgtcgttccgggtgatcagctgctgatccatgtgcgcaag
ctcaagaagcgcggcaatcttttgaagttcgcttgcgagggcaaggtcgacggtgtcgtc
gtagccgaggccgaggtgcaggcgatgatggtcgagaacgagcgaccgtaa

DBGET integrated database retrieval system