KEGG   Mesorhizobium sp. Pch-S: C1M53_29935Help
Entry
C1M53_29935       CDS       T05918                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
mesp  Mesorhizobium sp. Pch-S
Brite
KEGG Orthology (KO) [BR:mesp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mesp03012]
    C1M53_29935 (tuf)
   03029 Mitochondrial biogenesis [BR:mesp03029]
    C1M53_29935 (tuf)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mesp04147]
    C1M53_29935 (tuf)
Translation factors [BR:mesp03012]
 Eukaryotic Type
  Elongation factors
   C1M53_29935 (tuf)
 Prokaryotic Type
   C1M53_29935 (tuf)
Mitochondrial biogenesis [BR:mesp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    C1M53_29935 (tuf)
Exosome [BR:mesp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   C1M53_29935 (tuf)
  Exosomal proteins of breast cancer cells
   C1M53_29935 (tuf)
  Exosomal proteins of colorectal cancer cells
   C1M53_29935 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: QAZ46519
LinkDB All DBs
Position
complement(6303269..6304444)
Genome map
AA seq 391 aa AA seqDB search
MAKGKFERTKPHVNIGTIGHVDHGKTSLTAAITKYFGEYKPYDQIDAAPEEKARGITIST
AHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSKYEFPGDDIPIIKGSALAALEDSNKE
IGETAIRKLMEEVDAYIPTPERPIDKPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEL
EIVGIRPTTKTTCTGVEMFRKLLDQGQAGDNIGALLRGVDREGVERGQVLAKPGSVKPHK
KFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVSLPAGTEMVMPGDNITVDVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggtaaattcgagcgtacgaagcctcatgtgaacattggcacgattggtcac
gttgaccatggcaagacgtcgctgacggcagcgatcacgaagtactttggcgaatacaag
ccttacgatcagatcgacgcggctcctgaagagaaggcgcgcggcatcacgatctcgacg
gcgcacgtcgagtacgagacgccgaaccgtcactatgcgcacgtcgactgccccggccac
gccgactatgtgaagaacatgatcaccggtgccgcccagatggacggcgcgatcctggtt
gtttcggccgctgacggcccgatgccgcagacccgcgagcacatcctgcttgcgcgtcag
gttggcgttcctgcgatcgtggtgttcctgaacaaggtcgaccaggtcgacgacgccgag
cttctcgagctggtcgagctggaagttcgcgagcttctgtcgaagtacgagttcccaggc
gacgacattccgatcatcaagggctcggcgcttgctgctctggaagactccaacaaggag
atcggcgagactgcgatccgcaagctgatggaagaggttgacgcctacatcccgacgccg
gagcgtccgatcgacaagccgttcctgatgccgatcgaagacgtgttctcgatctcgggc
cgcggcacggttgtgacgggtcgcgtcgagcgcggcatcgtgaaggtcggcgaggaactg
gaaatcgtcggcatccgtccgaccacgaagacgacctgcacgggcgtcgagatgttccgc
aagctgctggaccagggccaggctggcgacaacatcggcgcgctgctgcgtggcgttgac
cgtgaaggcgtcgagcgcggccaggttctggccaagccgggttcggtgaagccgcacaag
aagttcaaggctgaagcctacatcctgacgaaggaagagggtggccgtcatacgccgttc
tttacgaactaccgtccgcagttctacttccgcacgacggacgtgacgggcatcgtctcg
ctgccggccggcaccgagatggtgatgcctggcgacaacatcaccgttgacgtcgagctg
atcgtgccgatcgccatggaagagaagctgcgcttcgctatccgcgaaggcggccgtacc
gtcggcgccggcatcgtcgcttccatcgtcgagtaa

DBGET integrated database retrieval system