KEGG   Mesorhizobium sp. WSM1497: A9K65_000220Help
Entry
A9K65_000220      CDS       T04915                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
mesw  Mesorhizobium sp. WSM1497
Pathway
mesw00250  Alanine, aspartate and glutamate metabolism
mesw00410  beta-Alanine metabolism
mesw00640  Propanoate metabolism
mesw00650  Butanoate metabolism
mesw01100  Metabolic pathways
mesw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mesw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A9K65_000220
   00650 Butanoate metabolism
    A9K65_000220
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A9K65_000220
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A9K65_000220
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mesw01007]
    A9K65_000220
Enzymes [BR:mesw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A9K65_000220
Amino acid related enzymes [BR:mesw01007]
 Aminotransferase (transaminase)
  Class III
   A9K65_000220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ARP61976
UniProt: A0A1W6WZL4
LinkDB All DBs
Position
complement(44589..45866)
Genome map
AA seq 425 aa AA seqDB search
MKNSAISERKNQSISRGVGMTTQIYADRAENSEIWDVEGRRYIDFSSGIAVVNTGHRHPR
VIDAVKAQLDRFTHTCHQVVPYESYVRLAERLNGMLPGKFEKKTIFVTTGAEAVENAIKI
ARNATGRQAVIAFAGGFHGRTFMGMALTGKVVPYKVGFGAMPGDVYHAPFPVPLHGVSVA
DSLAALDRLFKADVDPARVAAIIIEPVQGEGGFYDAPRDFLVALRKLCDQHGMLLIADEV
QTGFARTGKMFAMDHHEVAADITTMAKSLAGGFPLAAVTGRAEIMDAPGPGGLGGTYGGS
PIGVAAAHAVLDVIEDEKLCDRANTLGARLKQRLHSIRDDVPEIVDIRGLGFMNAVEFND
VKKGLPSAEIANAIRLKALDKGLILLTCGVYGNVIRFLAPITIQDEVMNEALDILESSIR
EVCAA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaagaattcagccatttccgaacgcaagaaccaatcgatttcccgcggcgtcggcatg
accacgcagatttatgccgaccgggctgaaaattcggaaatctgggatgtcgaggggcgt
cgctatatcgatttctcgtcgggcatcgccgtcgtcaacaccgggcatcgccatcccagg
gtgatcgacgcggtcaaggcacagctcgaccgcttcacccacacctgccaccaggtggtg
ccctatgagagctatgtgcgcctggccgaacggctgaacggcatgctgcccggcaagttc
gagaagaagacgatcttcgtcaccaccggggccgaggctgtcgagaacgccatcaagatc
gcccgcaatgccaccggccgtcaggcggtcatcgccttcgccggcggcttccatggccgc
accttcatgggcatggcgctgaccggcaaggtcgtgccttacaaggtcggcttcggcgcc
atgccgggcgatgtctaccatgcgccgtttcctgtgccgctgcacggtgtctcggtcgcc
gactcgctggcggcgctcgaccggttgttcaaggccgatgtggatccggcgcgcgtcgcc
gccatcatcatcgagccggttcagggcgagggcggcttctacgacgcgccgcgggatttc
ctggttgcgctgcgcaagctttgcgaccagcacggcatgctgctgatcgccgacgaagtg
cagaccggctttgcccgcaccggcaagatgtttgctatggatcaccatgaggtggccgcc
gacatcaccaccatggccaagagcctggccggcggctttcctctggcggcggtcaccggc
cgcgccgaaatcatggatgcgcccggccccggcgggctcggcggcacctatggcggcagt
ccgatcggcgttgccgcggcgcacgccgtgctcgacgtgatcgaggatgaaaagctgtgc
gaccgcgccaatacgctgggcgcaaggctgaaacagcggctgcactcgatccgcgacgac
gtgcccgagatcgtcgacatcagaggtctcggcttcatgaacgcggtcgagttcaacgac
gtcaagaagggcctgccctcagccgagatcgccaatgcgatccggttgaaggcgctcgac
aagggcctgatcctgttgacctgcggcgtctacggcaacgtcatccgcttcctggcgccg
atcaccatccaggacgaagtcatgaacgaagcactcgacattctggaaagctcgatccgc
gaagtctgcgccgcctga

DBGET integrated database retrieval system