KEGG   Mesorhizobium sp. WSM1497: A9K65_001725Help
Entry
A9K65_001725      CDS       T04915                                 

Definition
(GenBank) iditol 2-dehydrogenase
Organism
mesw  Mesorhizobium sp. WSM1497
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C adh_short NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ARP62243
UniProt: A0A1W6X196
LinkDB All DBs
Position
375889..376929
Genome map
AA seq 346 aa AA seqDB search
MVKTMKAVRLQAVGDITLRDVDMPDIGADELLVRIEACGVCGTDRHLFHGEFPCTPPVTP
GHEFSGIVEAIGKSVSGFAIGDRVTGDPNIACGRCAHCHAGQVNLCTNLCAIGIHRDGGF
ADYLALPQKQAFVLPAGLNPLHGAFCEPLGCCLHGVDLAGIKPGRSVVVLGGGVIGLLTV
QLARLAGATTIILSTRQASRRALAEDLGATATIDPTATDVIDAIAGPAGLAPGGVDVVFE
CAGVRETVEQSMRLARAGGTVVIVGVTPQGMKAEFEPFDLLFRELKVLGSFLNPYTHRRA
AELIASGAVEIDRLISRQVSLEEAPAVIANPPAPGEVKVLVVPRRG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagaccatgaaagcggtgcggctgcaagcagtgggcgacatcacgctgcgcgac
gtcgacatgcctgacatcggtgcggatgagctactggtgcgcatcgaagcctgcggcgtc
tgcggcacggaccggcatctgtttcacggtgaatttccttgcacgccaccggtgacgccc
ggccatgagttttccggcatcgtcgaggcgatcggaaaatcggtctcgggttttgccatc
ggcgatcgtgttaccggcgaccccaacatagcctgtgggcgctgcgcgcactgtcacgcg
ggacaagtcaatctctgcaccaatctgtgcgcgatcggcattcatcgcgacggcggcttt
gccgactatcttgccttgccgcagaaacaggctttcgtcctgcctgcaggcctgaacccc
ctgcacggtgccttctgcgagccgctcggctgttgcctgcatggcgtcgacctggccggt
atcaaaccgggcaggtcggtggtcgtgcttggcggcggcgtgatcggcctgctcaccgtg
cagctggcaagactggcgggagccacgaccatcatcctgtcgaccaggcaggcttcgcgg
cgcgccctcgccgaggacctcggcgcgacagcgacgatcgatccgacagccaccgatgtc
atcgatgcgatcgccggaccggccggtctggcgccaggtggcgtcgacgtcgtcttcgaa
tgcgccggcgtgcgagagaccgtcgagcagtccatgcggctggcccgagccggcggcacg
gtcgtcattgtcggcgtgacgccgcaaggcatgaaagcggaattcgagccgttcgacctg
ttgttccgggaactgaaggtgctcggttccttcctcaatccctacacccatcgccgcgcc
gccgaactcatcgcttccggtgcggtcgagatcgacaggctgatctccaggcaggtgtcg
cttgaagaagcgccagcggtgatcgccaatccgccggcgcccggcgaggtcaaggttctg
gtggtgccgcgccgcggctga

DBGET integrated database retrieval system