KEGG   Mesorhizobium sp. WSM1497: A9K65_002345
Entry
A9K65_002345      CDS       T04915                                 

Definition
(GenBank) histidine kinase
  KO
K14980  two-component system, OmpR family, sensor histidine kinase ChvG [EC:2.7.13.3]
Organism
mesw  Mesorhizobium sp. WSM1497
Pathway
mesw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mesw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A9K65_002345
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mesw01001]
    A9K65_002345
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mesw02022]
    A9K65_002345
Enzymes [BR:mesw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     A9K65_002345
Protein kinases [BR:mesw01001]
 Histidine kinases
  OmpR family
   A9K65_002345
Two-component system [BR:mesw02022]
 OmpR family
  ChvG-ChvI (acidity sensing)
   A9K65_002345
SSDB
Motif
Pfam: Stimulus_sens_1 Sensor_TM1 HATPase_c HisKA HAMP
Other DBs
NCBI-ProteinID: ARP62357
UniProt: A0A1W6X0K6
LinkDB
Position
complement(507697..509481)
AA seq 594 aa
MAVEAQRTRPAGASRRPSRIMPSFVSKITVPMRRFLGHHIFSSLTRRILFLNLAGLAVLV
TGILYLNTFRDGLIDARVESLMTQGEIIAGAIAASATVETDSISIDPEKLLELQAGESLG
PGSDQLDNLDFPINPERVAPVLRRLISPTRTRARIYDRDANLLLDSRHLYSRGQILRYDL
PPVEEEEPDLVERIQKFVFDFFRNTELPVYHEQPGGNGAAFPEVVKALTGSPSTIVRVSE
QGEQIVSVAVPIQRFRAVLGVLMLSTEGGDIDKIVAAERKAILRVFGIAALVTAILSMLL
ASTIANPLRRLSAAAVRVRRGVKSREEIPDFSDRQDEIGNLSIAIRDMTNALYARIEAIE
SFAADVSHELKNPLTSLRSAVETLPLAKNDDSRGRLMDIIQHDVRRLDRLITDISDASRL
DAELAREDAGTVDLKKFITDLVAVSREATRNKKAVEIEFKAAKLPQGVKGYVVVGHDLRI
GQVITNLIENARSFVPEDHGHISLSLARAGKFNIVTVDDNGPGIRADNIDRIFERFYTDR
PAGEAFGQNSGLGLSISRQIVEAHGGTLTAENIPGTKPGEIKGARFVVTLPAEG
NT seq 1785 nt   +upstreamnt  +downstreamnt
atggcagtggaagcacagcgaacaagaccggcgggcgcctccaggcggccgtcgcggatc
atgccgtccttcgtctcgaagatcacggtgccgatgcgccgcttccttggccatcacatc
ttttccagcctgacgcggcgtatcctgttcctcaaccttgccggcctcgccgtgctggtg
accggcatcctctatctcaacaccttccgcgacgggctgatcgacgcccgcgtcgaaagc
ctgatgacccagggcgagatcatcgccggcgccatcgccgcttcggcgacggtcgagacg
gattcgatcagcatcgacccggaaaagctgcttgaactgcaggccggcgaaagcctaggg
ccgggctccgaccagctcgacaatctcgatttcccgatcaacccggagcgtgtcgccccg
gtgctgcgaaggctgatctcgccgaccagaacccgcgcccgcatctatgaccgcgacgcc
aatctgctgctcgattcgcgccacctctattcgcgtggccagatcctgcgctacgacctg
ccgccggtcgaggaagaagagcccgatctggtcgagcgcatccagaaattcgtcttcgac
ttcttccgcaacaccgagctgccggtctatcacgagcagccgggcggcaatggtgccgct
ttcccggaagtggtcaaggcgctcaccggcagcccttcgaccatcgtgcgcgtcagcgag
cagggcgagcagatcgtttcggtggcggtgccgatccagcgctttcgtgccgtcctgggc
gtgctgatgctgtcgaccgaaggcggcgacatcgacaagatcgtcgccgccgagcgcaag
gcgatcctgcgcgtcttcggcatcgcggcccttgtcaccgccatcctgtcgatgctgctc
gcctcgaccatcgccaatccgctgcgccggctgtcggcggcggcggtgcgagtgcggcgc
ggcgtcaagagccgtgaggagatccccgacttttccgaccgccaggacgagatcggcaat
ctgtcgatcgccatacgcgacatgaccaacgcgctctacgcccggatcgaggcgatcgaa
agcttcgcggccgatgtctcgcacgagctgaaaaacccgctgacgtcgctgcgcagcgcg
gtggagaccttgccgctggccaagaacgacgattcgcgcggccggctgatggatatcatc
cagcacgatgtcaggcggctggaccggctcatcaccgatatttccgacgcatcgcgcctg
gacgcggaactcgcgcgtgaagatgcgggaacggtcgacctgaagaaattcatcaccgat
ctggtcgccgtttcgcgcgaagcgacgcgcaacaagaaggcggtcgagatcgagttcaag
gccgccaaactgccgcagggcgtcaaaggctatgtcgtcgtcggccatgatctgcgcatc
ggccaggtcatcaccaatttgatcgagaacgcccgttccttcgttcccgaggatcatggc
cacatcagcctgtcgctggcgcgtgccggcaagttcaacatcgtcaccgtcgacgacaat
ggccccggcatccgggccgacaacatcgaccgcatcttcgagcgcttctacacggatcgg
ccggccggcgaggccttcggccagaattcgggccttggcctgtcgatatccaggcaaatc
gtcgaggcccatggcggcacgctcaccgccgagaacatccctggcaccaaacccggcgag
atcaagggcgcgcgttttgtggtgacgttgccggccgaaggctga

DBGET integrated database retrieval system