KEGG   Mesorhizobium sp. WSM1497: A9K65_004035Help
Entry
A9K65_004035      CDS       T04915                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mesw  Mesorhizobium sp. WSM1497
Pathway
mesw03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mesw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    A9K65_004035
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mesw03400]
    A9K65_004035
Enzymes [BR:mesw01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     A9K65_004035
DNA repair and recombination proteins [BR:mesw03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     A9K65_004035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ARP62645
UniProt: A0A1W6X1F3
LinkDB All DBs
Position
835761..838274
Genome map
AA seq 837 aa AA seqDB search
MASLEQYHSKRDFKKTAEPAGKVARTKQGGAGGIFVIHKHAATRLHYDLRLEHDGVLWSW
AVTRGPSLDPHEKRLAVHVEDHPIDYAPFEGTIPKGEYGGGSVIVWDEGTWIPEIDPAKA
MKKGHISFELRGHKLHGAWHLVRLKPRAGEKRDNWLLIKSDDAAARPGEDILKEAPESVK
SGLTIEEVGEGKTAKGEKPKVWHSNKPAAVKTKAGKRLDFIEPQLATLERDAPPGKDWLH
EVKFDGYRMQAQIAGTDVRLLTRTGLDWTKKFGGEIVAELAGLKCSDAILDGEVVVLADS
GVSSFALLQQDLSAKRTNRFIYYVFDLMRLDGQDLRREPLVERKQALQELLGEQSDNAAV
RFSDHFAEPGKIMLEHACRMGLEGVVSKRADAPYRSGRGPTWVKSKCTARQEFVIGGYLP
SDKTGRGLRSILVGFHEGGKLHYAGRVGTGFSGKGANELKAKLDALTAKSSPFSTAVPKG
KGLVWVKPELVGEVEFRSWTSDRIIRHASFQGLREDKPAEEVVQEKPKAATGKPSTGKST
AKPASGGKAAGSMTTTVKLSHPDKLLWPDENISKQGLLDHYAQVWPRMEQFVVNRPLSLV
RAPDGVGGQRFFQKHASAGMSDKIARMKDPTDGEEILFIRDFDGVAALVQYGVVEIHIWG
CTIDEIEKPDQIIFDLDPDEGVDVKAVREAALDIRGKLDELSLPNFVKTSGGKGYHVLVP
LKPCAEWDAVKGFAHDFARALEQGAPDRYTATLSKKARTGKIFVDYLRNGRGSTTVAPYS
SRAKKGATVSMPVTWPEIEAGLPPNAFPIGDKTTLKQLAKADPWREFFKQGKALKRG
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atggccagcctcgaacaatatcattccaagcgcgatttcaagaaaaccgccgaaccggcc
ggcaaggtcgcccggaccaagcagggcggcgcgggcggcatcttcgtcatccacaagcat
gccgcgacgcggttgcattacgacttgcggctcgagcatgatggcgtgctgtggagttgg
gcggtgacgcgcggcccgagcctcgacccgcatgagaagcgactggctgtccatgtcgag
gatcacccgatcgactatgcgccgttcgaaggcaccattcccaagggcgaatatggcggc
ggttcggttatcgtttgggacgagggcacctggattcccgagatcgacccggccaaggcg
atgaaaaagggccatatcagcttcgagctcaggggacacaagctgcatggggcatggcat
ctggtgcggctgaagccgcgtgcgggtgaaaagcgcgacaactggctgctgatcaagtcg
gacgatgccgcagcgcgtcccggcgaggacatcctcaaggaagcgcctgaatcggtgaag
tccggcctgacgatcgaggaggtcggcgagggcaagaccgcgaagggcgagaagccgaaa
gtctggcattccaacaagccggccgccgtcaagacaaaagccggcaaacgcctcgacttt
atcgagccgcagctggccacgctcgagcgcgatgcgccgccgggcaaggactggctgcac
gaagtgaagttcgacggctatcgcatgcaggcgcagatcgccggcaccgatgtgcggctg
ctgacccgcaccggcctcgactggacgaagaaattcggcggcgagatcgtcgcggagttg
gccgggctgaagtgcagcgatgccatcctcgatggcgaggtggtggtgttggccgacagc
ggcgtctcgtctttcgcgctgctgcagcaggacctgtcggcgaagcggaccaatcgcttc
atctattacgtgttcgacctgatgcggctcgatgggcaggatcttcggcgcgagccgctg
gtcgagcgtaagcaggccttgcaggaactgctcggcgaacagtccgacaatgcggcggtc
cgcttcagcgaccatttcgccgaacccggcaagatcatgctggagcatgcctgccgcatg
ggcctggaaggcgtcgtctccaagcgtgccgatgcaccctaccgcagcggccgcggcccg
acctgggtcaaatcgaaatgcacggcgcggcaggaattcgtcatcggcggctacctgccg
tcggacaagaccgggcgcggactgcgctcgatcctggtcggcttccacgagggcggcaag
ctgcattatgccggccgcgtcggcactggtttttcgggcaagggcgccaatgagctgaag
gcaaaactcgatgcgttgacggcaaaatcatcgcccttctccaccgccgtgccgaagggc
aagggcctggtctgggtcaagcctgaacttgtcggcgaagtggagtttcgcagctggacc
tcggaccgtataatacgccacgcctcgttccaggggttgcgcgaggacaagccggcggag
gaagtcgtgcaggaaaagcccaaagcggcgacaggcaagccatcgacaggcaagagcacg
gccaagccggcatcaggcggcaaagccgccgggtcgatgacgaccacggtcaaactctcg
catcccgacaagctgctgtggccggacgaaaacatatccaagcagggcctgctcgaccat
tacgcacaggtttggccgcgcatggaacagttcgtggtcaaccggccgctcagcctggtg
cgggcgccggacggtgtcggcggccagcgtttcttccagaaacatgcctcggctggcatg
agcgacaagatcgcgcgcatgaaggacccgaccgacggcgaggagatcctgttcatccgg
gatttcgatggtgttgccgcactggtccagtatggcgtggtcgagatccacatctggggg
tgcacgatcgatgagatcgaaaagcccgaccagatcatcttcgatctcgacccggatgaa
ggcgtcgacgtgaaggcggtgcgcgaggcggcgctcgatatcagaggcaagctcgacgag
ctgtcgctgccgaatttcgtcaagacctcgggcggcaagggctatcacgtgctggtgccg
ttgaagccgtgtgccgaatgggacgcggtgaagggcttcgcccatgactttgcccgcgcg
ttggagcagggtgcccccgatcgctacacggcgacgctgtcgaaaaaagcgcgcacggga
aagatcttcgtcgactatctgcgcaacggcaggggctcgacgacggtcgcgccctattcc
tcgcgcgccaagaagggcgccaccgtgtcgatgccggtgacctggccagagatcgaggcc
ggcttgccgccgaacgctttcccgatcggcgacaagacgacgctgaagcagctggcgaaa
gccgatccgtggagggaatttttcaagcaggggaaggcgttgaagcgggggtag

DBGET integrated database retrieval system