KEGG   Mesorhizobium sp. WSM1497: A9K65_005120Help
Entry
A9K65_005120      CDS       T04915                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
mesw  Mesorhizobium sp. WSM1497
Pathway
mesw00020  Citrate cycle (TCA cycle)
mesw00310  Lysine degradation
mesw00380  Tryptophan metabolism
mesw01100  Metabolic pathways
mesw01110  Biosynthesis of secondary metabolites
mesw01120  Microbial metabolism in diverse environments
mesw01130  Biosynthesis of antibiotics
mesw01200  Carbon metabolism
Module
mesw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mesw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mesw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A9K65_005120
  09105 Amino acid metabolism
   00310 Lysine degradation
    A9K65_005120
   00380 Tryptophan metabolism
    A9K65_005120
Enzymes [BR:mesw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     A9K65_005120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ARP62833
UniProt: A0A1W6X2Z3
LinkDB All DBs
Position
1055057..1058044
Genome map
AA seq 995 aa AA seqDB search
MARQDQANDQFSLTSFLYGGNADYIDALYAAYEDDPASVNPEWQEFFAGLKDDSGDVRRN
AKGASWAKPSWPLQANGELVSALDGNWGIVEKTIEKKVKDKAVTNGVVLSDADVHQATRD
SVRAIMMIRAYRMRGHLHANLDPLGIAKPLEDYNELSPENYGFTEADYDRPIFLDNVLGL
EFGSIRQMLEILTRTYCSTLGVEFMHISDPEEKAWIQARIEGADKEITFTAAGKKAILQK
LVEAEGFEQFIDVKYKGTKRFGLDGSEALIPALEQIVKRGGQLGMKEIVLGMAHRGRLNV
LSQVMAKPHRAIFHEFKGGSAAPDEVEGSGDVKYHLGASSDREFDGNKVHLSLTANPSHL
EIVDPVVMGKARAKQDYLFGRSREEIVPLEERAKVLPLLLHGDAAFAGQGVIAEILGLSG
LRGHRVAGTLHFIINNQIGFTTNPRFSRSSPYPSDVAKMIEAPIFHVNGDDPEAVVHATK
VAIEFRMKFFKPVVVDMFCYRRFGHNEGDEPAFTQPIMYRNIRNHKTTVQIYGDRLIAEG
HLTQAELDQLKADWRAHLESEWEVGQHYKPNKADWLDGAWSGLRTADNQDEQRRGKTAVP
VKTLKEIGRKLTEVPKDFEAHKTIIRFLENRRQAIESGEGIDWSTAEALAFGAILLDGNP
IRLSGQDSERGTFSQRHSVLYDQRDETRYIPLNNLSAAQAGYEVINSMLSEEAVLGFEYG
YSLAEPKALTLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGYEGQGPEHS
SARLERFLQLCAEDNMQVANCTTPANYFHILRRQLKRDFRKPLILMTPKSLLRHKRAVST
LPEISGESSFHRLLWDDAQLLSGQAIKLVKDSKIRRVVLCSGKVYYDLYEEREKRGINDI
YLLRVEQLYPFPAKALITELSRFRNAEMVWCQEEPKNMGAWSFIDPYLEWVLAHIDAKHQ
RVRYTGRPAAASPATGLMSKHLAQLAALLEDALGE
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atggcaagacaagatcaggccaacgaccaattttctctcacctctttcctctatggcggc
aatgccgattacatcgacgcgctttacgccgcctatgaggacgatccagcctcggtcaat
cccgaatggcaggagttcttcgccgggctgaaagacgattccggcgatgtgcgcaggaac
gccaagggcgcctcctgggccaagccctcctggccgctgcaggccaatggcgaattggtg
tcggcgctcgacggcaattggggcatcgtcgagaagacgatcgaaaagaaggtcaaggac
aaggcggtcaccaatggcgtcgtcctgtccgacgccgacgtgcaccaggcgacgcgcgat
tcggtgcgcgccatcatgatgatccgcgcctaccgcatgcgcggccatctgcacgccaat
ctcgatccgctcggcatcgccaagccgctcgaggactacaacgagctgtcgccggaaaac
tacggcttcaccgaagccgattacgaccggccgatcttcctcgacaatgtgctggggctt
gaattcggcagcatccggcagatgctggaaatcctgacccgcacctattgctccacgctc
ggcgtcgagttcatgcatatttccgaccctgaggaaaaggcctggatccaggcgcgcatc
gagggtgccgacaaggagatcaccttcaccgccgccggcaagaaggcgatcctgcagaag
ctggtcgaggctgaaggcttcgagcagttcatcgacgtcaagtacaagggcaccaagcgc
ttcggcctcgatggcagtgaggcgctgatcccggcgctggagcagatcgtcaagcgcggc
ggccagctcggcatgaaggaaatcgtgctcggcatggcgcatcgcggccggctgaacgtg
ctctcccaggtgatggccaagccccaccgcgccatcttccacgagttcaagggcggctct
gcggcacccgatgaggtcgaaggctcgggcgacgtcaagtaccatctaggcgcctcgtcg
gaccgcgaattcgacggcaacaaggtgcatctgtccttgaccgccaacccctcgcatctg
gaaatcgtcgatccggtggtgatgggcaaggcgcgcgccaagcaggattatctgttcggc
cgcagccgcgaggaaatcgtgccgctggaagagcgcgccaaggtgctgccgctcttgctg
catggcgatgccgccttcgccggtcagggcgtgatcgccgagatcctcggcctgtccggc
ctgcgcggccaccgcgtcgctggcacgctgcatttcatcatcaacaaccagattggtttc
accaccaacccgcgcttttcgcgctcctcgccctatccgtccgacgtcgccaagatgatc
gaagcaccgatcttccacgtcaatggcgacgacccggaagccgtggtgcacgccaccaag
gtggcgatcgagtttcgcatgaagttcttcaagcctgttgtggtcgatatgttctgctat
cgccgcttcggccacaatgagggcgacgaaccggccttcacccagccgatcatgtaccgc
aacatccgcaaccacaagacgacggtgcagatctatggcgaccggctgatcgccgagggt
cacctcacccaggccgagctcgaccagttgaaagccgactggcgggcgcatctggaatcc
gaatgggaagtcggccagcactacaagcccaacaaggctgactggctcgacggcgcctgg
tcgggcctgcgcactgccgacaaccaggacgaacagcggcgcggcaagaccgccgtgccg
gtcaagacactgaaggaaatcggcaggaagctgaccgaggtgccgaaggacttcgaggcg
cacaagacgatcatccgcttcctcgaaaaccgccgccaggcgatcgagtccggcgaaggc
atcgactggtcgacggccgaggcgctggccttcggcgccatcctgctcgacggcaatccg
atccgcctgtcggggcaggattccgaacgcggcaccttctcgcagcgccattccgtgctc
tacgaccagcgcgacgagacccgctacatcccgctcaacaatctgtcggcggctcaggcc
ggctatgaagtcatcaactcgatgctgtcggaagaggcggttctgggcttcgaatacggc
tatagcctggccgagcccaaggcgctgaccttgtgggaagcgcagttcggcgacttcgcc
aacggcgcccaggtggtgttcgaccagttcatctcgtcaggcgaacgcaagtggctcaga
atgtcgggcctcgtctgcctgttgccgcatggctatgaaggccagggtccggaacattcc
tcggcccggctcgaacgcttcctgcagctttgcgccgaagacaacatgcaagtcgccaac
tgcaccacgccggccaactacttccacatattgcgccggcagctgaagcgcgacttccgc
aagccgctgattctgatgacgccgaagtcgctgctgcgccacaagcgggcggtgtcgacg
ctgccggaaatttcgggcgaaagctcgttccaccggttgctgtgggacgatgcgcagctg
ctttccggacaagcgatcaagctggtcaaggattccaagatccgccgcgtcgtgctgtgt
tcgggcaaggtctattacgacctctatgaggagcgcgaaaagcgcggcatcaacgacatc
tatctgctgcgcgtcgagcagctttacccgttcccggccaaggcgctgatcaccgaactg
tcgcggttccgcaatgccgagatggtgtggtgccaggaggagcccaagaacatgggcgcc
tggtcgttcatcgacccgtatctggaatgggtgctggcgcatatcgacgccaagcatcag
cgggtgcgctacaccggccgtccggccgccgcctcgccggcgaccggactgatgtcgaag
catctcgcccagctcgccgccttgctcgaagacgcgcttggtgaatag

DBGET integrated database retrieval system