KEGG   Mesorhizobium sp. WSM1497: A9K65_006995Help
Entry
A9K65_006995      CDS       T04915                                 

Definition
(GenBank) hypothetical protein
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
mesw  Mesorhizobium sp. WSM1497
Pathway
mesw00040  Pentose and glucuronate interconversions
mesw00051  Fructose and mannose metabolism
mesw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mesw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A9K65_006995
   00051 Fructose and mannose metabolism
    A9K65_006995
Enzymes [BR:mesw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     A9K65_006995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ARP67605
UniProt: A0A1W6XFL1
LinkDB All DBs
Position
complement(1428151..1429140)
Genome map
AA seq 329 aa AA seqDB search
MTATRFATRLNSFASRPQAEWPDLTGKPSLLQMAARAAKVGGLTDLDLNFPDHVSEKPAE
IALKLSDLGLSINGFAMRYYSNPAFKLGAFTNPDPAVRREAIDLTKAGIDAVREAGASLM
TLWLGQDGFDYAFQADYVTLWQHEIDGIREVAAHDPDCQISLEYKPNEPRSYSLMPDAAT
TLLAIRDVGLPNLGVTLDFAHVLYADEQPAFAAALVARHSKLLGVHLNDGYAKRDDGLMV
GAVHTLQTIELLRQIRRDGYAGAIYFDTFPDMTGLDPVRECEVNIATVKRMLRVVDRLGQ
DNRLSAAMDSQDAVTSQAIIQEIMLGPDS
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacagccactcgtttcgccacgcgcctgaattcctttgcctcgcggccgcaggccgaa
tggcctgatcttaccggcaagccgtcgctgctgcagatggcggcgcgcgccgccaaggtc
ggcgggcttaccgatctcgacctcaactttcccgaccatgtcagtgaaaagcctgcggaa
atcgccctcaaactgagcgatctcggactttctatcaatggctttgccatgcgctactac
tccaaccccgccttcaagctcggcgccttcaccaatccggatccggcggtgcgccgcgag
gccatcgacctgaccaaagccggcatcgatgccgtgcgtgaggccggcgccagcctgatg
acgctgtggctcggccaggatggcttcgactacgccttccaggccgactatgtgacgctt
tggcaacacgaaatcgatgggattcgtgaagtagcggcgcatgatcccgactgtcagatc
agccttgagtacaaaccgaacgaaccacgctcctacagcctgatgccggatgcggcgacg
accttgctggcgatccgcgatgtcggcctgcccaatctgggcgtcaccctcgatttcgcc
catgtgctctatgccgacgaacagccggcctttgccgcggccctggtggcgcgccacagc
aagctgctcggcgtgcatctgaacgacggctacgccaagcgcgacgacggcctgatggtc
ggcgcggtgcacacgctgcagaccatcgagttgctcaggcagattcgccgtgacggttac
gccggcgccatctatttcgacacgttccccgacatgaccgggctcgatccggtgcgcgag
tgcgaagtcaacatcgccaccgtcaagcgcatgctgcgcgtcgtcgaccggctggggcag
gacaatcgcctgtccgccgccatggacagccaggatgcggtgacgtcgcaggccatcatc
caggaaatcatgctcgggccggatagctga

DBGET integrated database retrieval system