KEGG   Mesorhizobium sp. WSM1497: A9K65_014475Help
Entry
A9K65_014475      CDS       T04915                                 

Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
mesw  Mesorhizobium sp. WSM1497
Pathway
mesw00910  Nitrogen metabolism
mesw02010  ABC transporters
Module
mesw_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:mesw00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    A9K65_014475
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    A9K65_014475
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mesw02000]
    A9K65_014475
Transporters [BR:mesw02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    A9K65_014475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Romo1
Motif
Other DBs
NCBI-ProteinID: ARP64442
UniProt: A0A1W6X6I4
LinkDB All DBs
Position
3008686..3009576
Genome map
AA seq 296 aa AA seqDB search
MSIQTIEDTKVKAFPAKPAEVIAFTAKARRRFEPLAIAGKLASALVPPIIVIALMLVVWQ
IACSSPTSSLPPPTQVWNEAYDLIAHPFFDNGPQDIGLAWRVLISLQRVAVGFGLAAVVG
VALGALVGQSIWAMRGLDPVFQILRTVPPLAWLPLSLAAFRDSSPSAIFVIFITSIWPII
INTAVGVRNIPEDYRNVSRILRLNQFEFFVKIMVPAAAPYIFTGLRIGIGLSWLAIVAAE
MLTGGVGIGFFIWDAWNSSRLPDIIVALAYIGVTGFCLDRLVAAVGAFVTRGTTAK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatccagactatcgaggacaccaaggtgaaggcctttcccgccaagccggcggag
gtcatcgccttcactgccaaggcacggcgccgcttcgagccgctcgccatcgccggcaaa
ctggcgagcgcgctggtgccgcccatcatcgtcatcgcgctgatgctggtcgtctggcag
atcgcctgttcgtcgccgacatcgagcctgccgccgccgacccaggtgtggaacgaggct
tacgacctgatagcgcatccgttcttcgacaatggcccgcaggatataggtctggcctgg
cgcgtgctgatctcgctgcagcgcgtcgccgtcggcttcggcctggcggcggtcgtcggc
gtcgcgctcggtgcgctggtcggccagtcgatctgggcgatgcgcggcctcgacccggtg
ttccagatcctgcgcacggtgccgccgctggcctggctgccgctgtcgctggcggcgttc
cgtgattccagcccgtcggcgatcttcgtcatcttcatcacctcgatctggccaatcatc
atcaacaccgcggtcggcgtgcgcaacattcccgaggactaccgcaacgtctcgcgcatc
ctgcggctcaaccagttcgaattcttcgtcaagatcatggtgccggccgccgcgccttac
atcttcaccggcttgaggatcggcatcggcctgtcctggctcgccatcgtcgccgccgaa
atgctgactggcggcgtcggcatcggcttcttcatctgggatgcgtggaactcgtcgcgg
ctgcccgacatcatcgtcgcgctcgcctatatcggcgtcaccggcttctgcctcgaccgg
ctggtcgcggcggtcggcgccttcgtcacccgcggcacaacggcaaagtga

DBGET integrated database retrieval system