KEGG   Mesorhizobium sp. WSM1497: A9K65_017090Help
Entry
A9K65_017090      CDS       T04915                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mesw  Mesorhizobium sp. WSM1497
Pathway
mesw00473  D-Alanine metabolism
mesw00550  Peptidoglycan biosynthesis
mesw01100  Metabolic pathways
mesw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mesw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A9K65_017090
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A9K65_017090
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    A9K65_017090
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mesw01011]
    A9K65_017090
Enzymes [BR:mesw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A9K65_017090
Peptidoglycan biosynthesis and degradation proteins [BR:mesw01011]
 Precursor biosynthesis
  Amino acid ligase
   A9K65_017090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: ARP64894
UniProt: A0A1W6X7V2
LinkDB All DBs
Position
3523026..3523952
Genome map
AA seq 308 aa AA seqDB search
MKNKHVAVLLGGFSSERPVSLSSGKACADELEKEGYQVTRVDVGRDVGSVLAELKPDVAF
NALHGPFGEDGTIQGILEYLGIPYTHSGVLASALAMNKEQAKRVAKSVGIVVAESKVASR
FAIQNKHPMKPPYVVKPVNEGSSFGVVIVHEGQSHPPQVLGSSEWKYGDTVMVERYIHGR
ELTCAVMGDVALGVCEIIPTGHSFYDYDSKYVAGGSKHECPAKVSPNIYQKIQTLALKAH
QAIGCRGVSRSDFRYDDRHSENGEIVWLEVNTQPGMTPTSLVPEIAAQAGHSFGDLLSWM
VEDASCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaagcatgtggccgtcctgctgggtggtttttcgtccgagcggcccgtgtcc
ctgtcctccggaaaggcttgcgccgatgagcttgagaaggaaggttaccaggtcacccgc
gtcgatgtcgggcgcgatgtcggctccgtgcttgccgagctcaagcccgatgtcgccttc
aatgcgctgcacggcccttttggtgaggatggcaccatccagggcatcctcgaatatctc
ggcattccctacacccattccggcgtgctcgcctcggctctggccatgaacaaggagcag
gccaaacgggttgccaagtcggtcggcatcgtggtcgccgaatcgaaggtcgccagccgc
ttcgccatccagaacaagcatccgatgaagccgccctatgtggtcaagccagtcaatgag
ggctcaagcttcggcgtcgtcatcgtgcatgaaggtcagtcgcatccgccgcaggttctt
ggctcgtcggaatggaaatatggcgataccgtcatggtcgagcgctacattcacggcagg
gagctgacctgcgcggtgatgggcgatgtggcgctgggggtctgcgagatcatcccgacc
ggccattccttctacgactatgattcaaaatatgtcgccgggggatcaaagcacgaatgc
cccgcaaaagtttcaccgaatatttaccaaaaaatacaaacactggcgctcaaggctcac
caagcgatcggctgtcggggcgtttcccggtcggacttccgttatgacgatcggcattcc
gaaaacggcgagattgtctggctcgaggtcaacacccagccgggtatgacgccgacgtcc
ttggtgcctgaaatcgccgcccaggccgggcactcgtttggcgatttgttgagttggatg
gtggaggacgcttcgtgtctgcgttga

DBGET integrated database retrieval system