KEGG   Mesorhizobium sp. WSM1497: A9K65_023735Help
Entry
A9K65_023735      CDS       T04915                                 

Gene name
rbcL
Definition
(GenBank) ribulose-bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mesw  Mesorhizobium sp. WSM1497
Pathway
mesw00630  Glyoxylate and dicarboxylate metabolism
mesw00710  Carbon fixation in photosynthetic organisms
mesw01100  Metabolic pathways
mesw01120  Microbial metabolism in diverse environments
mesw01200  Carbon metabolism
Module
mesw_M00165  Reductive pentose phosphate cycle (Calvin cycle)
mesw_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:mesw00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A9K65_023735 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    A9K65_023735 (rbcL)
Enzymes [BR:mesw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     A9K65_023735 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ARP66016
UniProt: A0A1W6XB74
LinkDB All DBs
Position
4847613..4849106
Genome map
AA seq 497 aa AA seqDB search
MNKIDILPAGTLKEGKERYKSGVIPYKKMGYWEPDYRPKETDLIAMFRITPQPGVDHEEA
AAAIAGESSTATWTVVWTDRLTACELYRAKAFRSEPVPNTGPGTKTEQQYFAYIAYDLDL
FEPGSIANLTASIIGNVFGFKAVKALRLEDMRIPVAYLKTFQGPATGIVVERERLDKFGR
PLLGATTKPKLGLSGRNYGRVVYEALKGGLDFVKDDENINSQPFMHWRDRFLYCMEAVNK
ASAATGEVKGHYLNVTAGTMEEMYERAEFAKQLGSCIVMIDLVIGYTAIQSMAKWARRND
MILHLHRAGNSTYSRQKNHGMNFRVICKWMRMAGVDHIHAGTVVGKLEGDPLMIKGFYDT
LREERTPQNLETGLFFDQEWASLNKVMPVASGGIHAGQMHQLIHYLGEDVILQFGGGTIG
HPDGIQAGATANRVALEAMILARNEGRDYLREGTKILEQAARWCTPLKAALETWKDVTFN
YESTDTADFVPTATPSF
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagatcgacatactgccagcggggacgctcaaggaaggcaaggagcgctacaag
tcaggggtcatcccctacaagaagatgggctactgggagcctgactacaggcccaaggaa
accgatctgatcgccatgttccggatcacgccgcaacccggtgtcgaccatgaggaggcg
gcagccgccatcgccggtgaatcctccaccgcaacgtggaccgtggtgtggaccgaccgg
ctgacagcttgcgagctctatcgcgccaaggcgttcagatccgagccggtgccgaacacc
ggtcccggaaccaagaccgagcaacagtacttcgcctacatcgcctacgacctcgacctg
ttcgagccgggctcgatcgccaacctgaccgcatcgatcatcggcaatgtgttcggcttc
aaggcagtcaaggctttgcggctggaagacatgcgtatcccggtggcgtatctcaaaact
ttccaggggccggcgaccggcatcgtggtggagcgtgagcggctcgacaagttcggccgg
ccgctgctcggcgcgacgacgaagccgaagctcggcctgtcgggacgcaattacgggcgc
gtcgtttatgaagcgctgaagggcggcctcgacttcgtcaaggacgacgagaacatcaac
tcacagcccttcatgcattggcgcgaccgcttcctctactgcatggaggccgtgaacaag
gcgtcggctgccaccggcgaggtcaagggccattacctcaacgtcaccgccggcacgatg
gaggagatgtacgagcgcgccgaattcgccaagcaacttggctcctgcattgtgatgatc
gatctggtcatcggctacacagcgatccagtcgatggccaagtgggcacgccgcaacgac
atgatcctgcacctgcaccgtgccggcaactcgacctattcgcgccagaagaaccacggc
atgaatttccgcgtcatctgcaaatggatgcgcatggccggcgtcgaccacatccatgcc
ggcacggtggtcggcaagctggaaggcgacccgctcatgatcaagggattttatgacacg
ctgcgcgaggagcgcacgccgcagaacctcgaaaccgggctgttcttcgatcaggaatgg
gcctcgctcaacaaggtgatgcccgttgcctcgggcggcatccatgccggccagatgcac
cagttgatccactatctcggcgaggatgtcatcctgcagttcggcggcggcacgatcggc
catccggacggtatccaggcaggcgcgacggccaatcgcgtcgccttggaagcgatgatc
ctggcccgcaacgaggggcgcgattatttgcgcgaagggaccaagatcctcgaacaggcg
gccagatggtgcacgccgctgaaggctgccctggagacctggaaggacgtcaccttcaac
tacgaatcgaccgacacggccgacttcgtgccaaccgcaacgcccagcttctag

DBGET integrated database retrieval system