KEGG   Mesorhizobium sp. WSM1497: A9K65_023740Help
Entry
A9K65_023740      CDS       T04915                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
mesw  Mesorhizobium sp. WSM1497
Pathway
mesw00630  Glyoxylate and dicarboxylate metabolism
mesw00710  Carbon fixation in photosynthetic organisms
mesw01100  Metabolic pathways
mesw01120  Microbial metabolism in diverse environments
mesw01200  Carbon metabolism
Module
mesw_M00165  Reductive pentose phosphate cycle (Calvin cycle)
mesw_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:mesw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A9K65_023740
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    A9K65_023740
Enzymes [BR:mesw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     A9K65_023740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ARP66017
UniProt: A0A1W6XB06
LinkDB All DBs
Position
4849125..4849559
Genome map
AA seq 144 aa AA seqDB search
MMTNPGNKVTQGQFSFLPDLTDEQISAQIKYALKNHWAVSVEYTDDPHPRNTYWEMYGNP
MFDLKDPAGILLEVNACRKACPNMYVRVTAFDSTKGWEAPRMSFIVNRPPSEPGFRLLRQ
ERDGRSQGYSIVPYATDRPEGERS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaatccgggaaacaaggtcacacaggggcagttctcgttcctgcccgacctg
accgacgagcagatttcggcgcagatcaaatacgcgctgaagaaccattgggcggtcagc
gtcgagtacacggacgatccgcatccgcgaaacacctattgggaaatgtacggcaacccc
atgttcgacttgaaagatccggcgggcatactgctcgaggtcaatgcttgccggaaagcc
tgtccgaacatgtatgtgcgggtaaccgccttcgattcgaccaagggctgggaagcgccg
cgcatgtcgttcattgtcaaccggccgcccagcgaacccgggttccggctgctgcgccag
gagcgtgacggccgcagccagggttattcgatcgtgccttatgcgaccgacaggcccgag
ggcgagcggagctag

DBGET integrated database retrieval system