KEGG   Mesorhizobium sp. WSM1497: A9K65_027005Help
Entry
A9K65_027005      CDS       T04915                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mesw  Mesorhizobium sp. WSM1497
Brite
Enzymes [BR:mesw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A9K65_027005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ARP66591
UniProt: A0A1W6XCP2
LinkDB All DBs
Position
complement(5479134..5479733)
Genome map
AA seq 199 aa AA seqDB search
MAFELPALPYDYEALQPYMSKETLEYHHDKHHKAYVDNGNKLAAEAGLGDLSVEEVVKQS
FGKNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGALQKAVDSDLGGYDKFKADFIAAGT
TQFGSGWAWVSVKDGKLAISKTPNGENPLVHGASPILGVDVWEHSYYIDYRNARPKYLEA
FVDSLINWDHVLELYEKAK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcctttgaattgcccgctctgccttacgactatgaggccttgcagccttacatgtcg
aaagagacgctggaatatcaccacgacaagcaccacaaggcgtatgtcgataacggcaac
aaactcgccgccgaggccggcttgggcgatctgtcggtcgaagaggtggtcaagcagtcg
ttcggcaagaatgccggcctcttcaacaatgccgcccagcattacaaccacatccatttc
tggaagtggatgaagaaaggcggcggcggcaacaagctgccgggcgccttgcagaaggca
gtcgatagcgatctcggcggctacgacaagttcaaggccgacttcattgccgctggcacg
acacagttcggctccggctgggcctgggtctcggtcaaggatggcaagctggcgatctcc
aagacaccgaacggcgaaaacccgctcgtccatggcgcgtcgccgatcctcggcgtcgat
gtctgggagcactcctactacatcgactaccgcaacgcccggccgaaatatctcgaggcg
ttcgtcgacagcctgatcaactgggaccatgtcctggaattgtacgaaaaggcgaagtga

DBGET integrated database retrieval system