KEGG   Mesorhizobium sp. WSM1497: A9K65_033190
Entry
A9K65_033190      CDS       T04915                                 

Definition
(GenBank) type VI secretion lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
mesw  Mesorhizobium sp. WSM1497
Pathway
mesw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mesw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A9K65_033190
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mesw02044]
    A9K65_033190
Secretion system [BR:mesw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A9K65_033190
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: ARP68254
UniProt: A0A1W6XHG6
LinkDB
Position
pWSM1497:161311..161763
AA seq 150 aa
MIDRREFVVALGATGLLAACQSGPPKPSVITVNVNGGAGMNPGPGGGDRPVTILVMRLKS
TGKFNSADYFALQGDAGTALAGDLIGSDQISVGPGKSASKTITVEPDATALGFVALIREP
GGRNWRTTKSVSSGSKFTINVTLGSGGISA
NT seq 453 nt   +upstreamnt  +downstreamnt
atgattgatcgacgtgaatttgttgttgccttgggcgcgacagggttgcttgcggcttgc
cagagtggtccgccgaaaccatcggtgatcaccgtcaacgtaaacggcggtgctggcatg
aacccgggaccaggcggcggcgaccggccggtaacgatcctggtgatgcggctgaaaagc
accggcaaattcaattccgccgactatttcgcgctgcagggggatgccggcacggcgctg
gcgggcgatctcatcggatccgaccagatttccgtcgggccgggaaaatccgcatccaaa
accatcacggtcgagccggacgcgacggcgctgggctttgttgctctgatccgcgagccc
ggcggccggaactggcggacaaccaagtcggtgtcgtcgggatcgaaattcacgatcaac
gtcacgcttggcagcggcggcatttccgcctag

DBGET integrated database retrieval system