KEGG   Methylobacterium sp. 4-46: M446_0922Help
Entry
M446_0922         CDS       T00679                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00473  D-Alanine metabolism
met00550  Peptidoglycan biosynthesis
met01100  Metabolic pathways
met01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:met00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    M446_0922
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    M446_0922
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    M446_0922
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:met01011]
    M446_0922
Enzymes [BR:met01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     M446_0922
Peptidoglycan biosynthesis and degradation proteins [BR:met01011]
 Precursor biosynthesis
  Amino acid ligase
   M446_0922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ACA15471
UniProt: B0UB90
LinkDB All DBs
Position
1044228..1045376
Genome map
AA seq 382 aa AA seqDB search
MRRNVALLFGGRSAEHEVSIVSAGNVARALDPDRYAVTPIAIDKETGAWRLCPPLAPGEA
PAMVREGPRVAFLPGGGGRLAVLGETASVSEPFDVVVPVLHGPNGEDGTVQGALDLAGVP
YVGSGVIGSAAAMDKDVAKRLMRDAGLPIVPYLVAGPRRGVAYTEAVEALESRTLFVKPA
NMGSSVGVSRVADAGQFDQALAHAFAYDEKILIERAVPRAREIEFAVLETAEGEVRVSPP
GEIAPAAAHGFYGYDAKYVDPDGAALLIPASLAPALAERMGGLAARAFEALACAGLARVD
LFLDPDDPEGIFVNEVNTLPGFTAISMYPKLWDAAGLAPPALMDALIAHALARHARAVAT
GRAAPRSAADAAWAPMRESISR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcggaggaatgtggcgctgctgttcggagggcgctcggccgagcacgaggtgtcgatc
gtctcggccggcaacgtcgcccgggcgctcgatccggatcgctacgcggtgacgccgatc
gccatcgacaaggagacgggcgcgtggcggctctgcccgccgctcgcgcccggcgaggcg
cccgcgatggtgcgggaggggccgcgcgtcgccttccttccgggcggcggcggccggctc
gcggtgctgggggagacggcgagcgtgtcggagcccttcgacgtcgtcgtgccggtgctg
cacgggccgaacggcgaggacgggaccgtgcagggcgccctcgacctcgcgggcgtgccc
tatgtggggtcgggggtcatcggctcggccgccgcgatggacaaggacgtggccaagcgc
ctgatgcgcgacgcgggcctgccgatcgtgccctacctggtggcggggccgcggcgcggg
gtcgcctacacggaggcggtcgaggcgctggagagccggacgctgttcgtgaagcccgcc
aatatgggctcctcggtcggcgtctcgcgggtcgccgatgcgggccagttcgaccaggcg
ctggcccacgccttcgcgtacgacgagaagatcctgatcgagcgggccgtgccgcgggcg
cgggagatcgagttcgcggtgctggagacggcggagggagaggtgcgggtgtcgccgccg
ggggagatcgccccggccgccgcgcacggcttctacggctacgacgccaagtacgtcgat
ccggacggggcggccctgctgatcccggcgagcctcgcgcccgcgctcgccgagcggatg
ggcgggctggcggcccgggccttcgaggccctcgcctgcgcggggctcgcccgggtcgac
ctcttcctcgacccggacgacccggagggaatcttcgtcaacgaggtcaacaccctgccg
ggcttcacggcgatcagcatgtacccgaaattgtgggacgcggcgggcctcgcgccgccc
gcccttatggacgccctgatcgcccacgccctcgcccgccacgcccgggccgtcgccacg
ggccgggctgccccgcgatcggcggcggatgcggcgtgggcgccgatgcgcgagagcatt
tcccgctga

DBGET integrated database retrieval system