KEGG   Methylobacterium sp. 4-46: M446_1384Help
Entry
M446_1384         CDS       T00679                                 

Definition
(GenBank) conserved hypothetical protein
Organism
met  Methylobacterium sp. 4-46
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF58
Motif
Other DBs
NCBI-ProteinID: ACA15900
UniProt: B0UJG2
LinkDB All DBs
Position
1524526..1525446
Genome map
AA seq 306 aa AA seqDB search
MARPSPPDDPLAQPGVAVDAAALMGLRHLARRGGGLATRSLVGLPGGIVTRRRGRGSEPD
DVRPYAEGDDVRHIDRNATARTGVLHTRTHHEERDRAVVLLADFRPSMLFGTRRALRSVA
AAEALALLGWRIVEDGGRIGLVVASTEAEPVVLRPTGGGRGMGALAGALARAHALALAAP
PARDPPLLATLARAQTLLPAGGHLVIASSLDEPGEGFAAALTALAERVSLSLILVSDAFE
RAPPPGLYPFATPDGRRGTAAAGRAAPPPDDRLSRWARAGLEGVRLDSEGGPESFAPLME
RLDAVL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtggcccgcccctccccgcccgacgatcccctggcgcagcccggcgtcgcggtcgacgcg
gccgccctgatgggccttcgccacctcgcccgccggggcggcggcctcgccacgcgcagc
ctcgtcggcctgccgggcgggatcgtgacccggcgccgcggtcgcggctccgagcccgac
gacgtgcgcccctacgcggagggggacgatgtccgccacatcgaccgcaacgccacggcg
cggacgggcgtcctgcacacgcgcacccaccatgaggagcgcgaccgggcggtggtgctg
ctggccgatttccggccctccatgctgttcggcacgcggcgggccctgcgctccgtggcg
gcggcggaggcgctcgccctcctgggctggcgcatcgtggaggatggcgggcggatcggc
ctcgtggtcgcctcgacggaggcggagccggtggtcctgcgcccgaccggcggcgggcgc
ggcatgggggcgctcgccggcgccctcgcccgggcgcacgcgctggcgctcgccgcgccc
ccggcgcgggacccgcccctgctcgccaccctcgcccgcgcccagaccctgctgccggcg
gggggacacctcgtgatcgcgagctccctggatgaacccggagagggattcgcggcggcc
ctgaccgcgctcgccgagcgggtctcgctcagcctgatcctggtgagcgacgccttcgag
cgcgccccgccccccggcctctaccccttcgccacgccggacgggcgccggggcaccgcc
gcggccgggcgcgccgcgccgccgcccgacgaccgcctctcccgctgggcgcgggccggg
ctcgaaggcgtgcggctcgacagcgagggcggcccggaatccttcgccccgctgatggag
cgcctcgatgccgtgctgtga

DBGET integrated database retrieval system