KEGG   Methylobacterium sp. 4-46: M446_1565Help
Entry
M446_1565         CDS       T00679                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00061  Fatty acid biosynthesis
met00780  Biotin metabolism
met01100  Metabolic pathways
met01130  Biosynthesis of antibiotics
met01212  Fatty acid metabolism
Module
met_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:met00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    M446_1565
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    M446_1565
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    M446_1565
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:met01004]
    M446_1565
Enzymes [BR:met01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     M446_1565
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     M446_1565
Lipid biosynthesis proteins [BR:met01004]
 Fatty acid synthase
  Component type
   M446_1565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ACA16066
UniProt: B0UMC7
LinkDB All DBs
Position
complement(1748590..1749372)
Genome map
AA seq 260 aa AA seqDB search
MTQIPDGNALAGKNALVLGVANEHSIAYGCARVFRRLGARIALTYLNEKARPFVEPLARE
LDAPLFLPCDVQREGELEAVFRQIAESWGRLDIALHSIAFAPRADLQGRLVDSSGEGFGI
AMDVSCHSFIRMARLAAPLMHEGGTLLTMSYHGASKVVPNYNLMGPVKAALESAVRYLAY
ELGDRDIRVHAVSPGPLKTRAASGLKDFDLLLNEAIQRSPIGELVDIDDVGLTAAYLTTP
YAARLTGMTVYVDGGLSIMA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagatccccgatggcaacgcccttgcgggcaagaacgcgctggtgctcggcgtc
gccaacgagcactcgatcgcctacggctgcgcgcgcgtcttccggcggctcggggcgcgg
atcgccctgacctacctcaacgagaaggcgaggcccttcgtcgagccgctcgcgcgcgaa
ctcgacgcgccgctcttcctgccctgcgacgtccagcgggagggggagctcgaggcggtg
ttccggcagatcgccgagagctggggccgcctcgacatcgcgctccactcgatcgccttc
gcgccgcgcgccgacctccagggccggctggtcgacagttcgggcgaggggttcgggatc
gccatggacgtgtcctgccactccttcatccgcatggcgcggctcgccgcgccgctgatg
cacgagggcggcacgctgctcaccatgagctaccacggcgccagcaaggtggtgccaaac
tacaacctgatgggacccgtcaaggcggcgctggagagcgccgtgcgctacctcgcctac
gagctcggcgaccgcgacatccgcgtccacgcggtgtcgccgggccccctcaagacccgc
gccgcctcgggcctgaaggatttcgacctcctcctcaacgaggcgatccagcgctcgccc
atcggcgaactcgtggacatcgacgatgtcgggctcaccgccgcctacctgacgacgccc
tacgccgcccgcctgaccggcatgacggtctacgtcgacggcggcctcagcatcatggct
tga

DBGET integrated database retrieval system