KEGG   Methylobacterium sp. 4-46: M446_1661Help
Entry
M446_1661         CDS       T00679                                 

Definition
(GenBank) heavy metal translocating P-type ATPase
  KO
K17686  P-type Cu+ transporter [EC:7.2.2.8]
Organism
met  Methylobacterium sp. 4-46
Brite
Enzymes [BR:met01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.8  P-type Cu+ transporter
     M446_1661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1-E2_ATPase Hydrolase HMA HAD Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: ACA16154
UniProt: B0UQ23
LinkDB All DBs
Position
1857591..1860068
Genome map
AA seq 825 aa AA seqDB search
MTATARRLTLPVEGMTCASCTGRVERVLKAVPGVTSASVNLATRRATIELAPDNHPGALA
EAIADAGYAVPEQTSDFLVEGMTCASCVGRVERVLRAVPGVTEASANLATGRVSVRHPGG
LVEEAALARAVAAAGYALRPLPAAAPETPALPEEAVGLRRDLVVAALLALPVVVLDMGGH
LIGAHRLHALVPEGWSNGVQAVLATLVLAGPGRRFFRRGVPGLLRGHPDMNALVALGTGA
AYGFSLVATLAPGLLPEGTAHVYFEASVLIITLILLGRFLEARAKGRTGAAIARLVGLAP
RTARVIRPEGEVEVPVVDLRPGDRVRVRPGERLPADGRVAAGASAVDESMITGEPVPARK
EAGAPVTGGTVNGTGSLEVAVERVGADTVLSQIIRMVEAAQGAKLPIQALVDRVTGWFVP
AVMGLAALTFLAWLLLGPAPALGLALVNAIAVLIIACPCAMGLATPTSIMVGTGRAAERG
ILFRNGTALQALEGVRAVAFDKTGTLTEGHPALTDLIPAPGDAAESALAESALAESALAE
TALAHAAALESRSEHPLARAIVAGARARGLALPPVEAFEAVPGFGLVGRAGGRAVAIGAA
RHLARLGIPVAPLAEAAARLGEAGRSPLYVALDGRLAALIAVADPVKPGAAAAVAALQGR
GVAVALVTGDDRRTAEGIARELGIATVLAEVLPADKLAAVREMRAAHGRTAFVGDGINDA
PALAEADVGIALGTGTDVAVESADVVLMAGDPGGVVEALHLSRAVMRNIRQNLFWAFAYN
AALLPVAAGMLRLFGGPLLSPVLAAGAMALSSVFVVGNALRLRRA
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgaccgcccgccgcctcaccctgcccgtggagggcatgacctgcgcctcctgc
acggggagggtcgagcgcgtgctcaaggccgtgccgggcgtcacctcggcctccgtcaac
ctcgccacccgccgcgccaccatcgagcttgcccccgacaaccatccgggcgccctggcc
gaggcgatcgcggatgccggctacgccgtccccgagcagacctcggacttcctcgtcgag
ggcatgacctgcgcctcctgcgtcggccgggtcgagcgggtgctcagggcggtgccgggc
gtcaccgaggccagcgccaacctcgccaccgggcgggtcagcgtgcgccatcccggcggg
ctggtggaggaggccgccctggcccgggccgtggccgcggccggctacgcgctgcggccg
ctgccggccgccgcgccggagacccccgccctgcccgaggaggcggtcgggctgcgccgc
gacctcgtcgtcgccgccctgctggcgctgcccgtcgtggtcctcgacatgggcggccac
ctgatcggcgcccatcgtctgcacgccctcgtgccggagggctggagcaacggcgtccag
gccgtgctcgccacgctcgtcctcgcgggcccgggccggcgcttcttccggcgcggcgtg
ccgggcctgctgcgcggccacccggacatgaacgccctcgtcgccctcggcacgggcgcc
gcctacggcttctcgctcgtcgccaccctggcgcccggcctgctgccggaggggacggcc
cacgtctatttcgaggcctcggtcctcatcatcaccctgatcctgctcgggcgcttcctg
gaggcgcgggcgaaggggcgcaccggcgcggcgatcgcgcgcctcgtcgggctggcgccg
cggaccgcccgggtcatccgccccgagggcgaggtcgaggtcccggtggtggacctgcgc
cccggcgaccgcgtgcgggtgcgcccgggcgagcgcctgcccgccgacgggcgcgtcgcc
gcgggcgcctccgcggtcgacgagagcatgatcaccggcgagccggtgccggcgcgcaag
gaggccggggcgccggtcacgggcggcaccgtcaacggcaccggcagcctggaggtcgcg
gtcgagcgcgtcggcgccgacacggtcctctcgcagatcatccgcatggtcgaggcggcc
cagggggccaagctgccgatccaggccctcgtcgatcgggtcaccggctggttcgtgccg
gccgtgatgggcctcgccgccctgaccttcctggcctggctgctgctcggccccgcgccc
gccctgggcctcgccctggtcaacgccatcgcggtgctgatcatcgcctgcccctgcgcg
atgggcctcgccacgccgacctcgatcatggtcgggaccgggcgggcggccgagcgcggc
atcctgttccgcaacggcaccgccctgcaggcgctggagggtgtgcgggccgtggccttc
gacaagaccggcaccctgaccgagggccaccccgcgctcaccgacctgatccccgccccc
ggggacgcggccgaatccgccttggccgaatccgccttggccgaatccgccttggccgag
acagccctggcgcacgcggccgccctggaatcccgctccgagcacccgctcgcccgggcg
atcgtcgcgggggcgcgggcgcggggcctcgcccttccgccggtcgaggccttcgaggcg
gtgccgggcttcggcctcgtcggacgggcgggcgggcgcgcggtcgcaatcggcgcggcg
cggcacttggcgaggctcggcatcccggtcgcgcccctcgcggaggcggcggcccggctc
ggcgaggccggccgctcgcccctctacgtcgcgctcgacggccgcctcgccgccctgatc
gcggtggccgatccggtgaagccgggcgccgccgcggcggtcgcggccctgcagggacgg
ggcgtggccgtggcgctggtgaccggcgacgaccggcgcacggccgagggcatcgcccgc
gagctcggcatcgccacggtgctggccgaggtgctgcccgccgacaagctcgcggcggtg
cgggagatgcgcgccgcccacggccgcaccgccttcgtgggcgacggcatcaacgacgcg
ccggcgctggccgaggcggatgtcggcatcgcgctcggcacgggcaccgacgtcgcggtg
gagagcgccgacgtggtgctgatggcgggggatcccggcggcgtggtcgaggcgctccac
ctctcgcgcgcggtgatgcgcaacatccgccagaacctgttctgggccttcgcctacaac
gccgcgctgctgccggtcgcggcgggcatgctgcgcctcttcggcggcccgctcctgtcg
cccgtcctcgccgccggcgccatggccctgtcgagcgtgttcgtggtcggaaacgcgctg
cgccttcgccgcgcctga

DBGET integrated database retrieval system