KEGG   Methylobacterium sp. 4-46: M446_1732Help
Entry
M446_1732         CDS       T00679                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00630  Glyoxylate and dicarboxylate metabolism
met00710  Carbon fixation in photosynthetic organisms
met01100  Metabolic pathways
met01120  Microbial metabolism in diverse environments
met01200  Carbon metabolism
Module
met_M00165  Reductive pentose phosphate cycle (Calvin cycle)
met_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
met_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:met00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    M446_1732
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    M446_1732
Enzymes [BR:met01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     M446_1732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ACA16223
UniProt: B0U7K1
LinkDB All DBs
Position
1947301..1948572
Genome map
AA seq 423 aa AA seqDB search
MQPVPAPPARIEADYLLESVVDPRRAAEIIAGEQSSGTFVPVPGETPELKARAAARIERL
DLLDEAVAAPALPSAGIPAGAAARRARLTLSWPLDNLGPSLPNLLATVAGNLFELKPVTG
LRLLDIRLPEAFARAYPGPRFGVAGTRRLAGIEGRPLIGTIIKPSVGLDPQQTAALVASL
CAGGIDFIKDDELQADGPHCPFDARVRAVMREVRAHRDRTGRAVMVAFNLTGDLDQMRRR
HDLLVAEGATCLMASLNSVGLVGMIELGRFSALPIHAHRNGWGYLSRHPLLGWSYVAWQK
IWRLAGADHMHVNGLANKFAEPDDSVVASARTCLTPLFPDKPCLAMPVFSSGQSVRQAPG
TYRALGGTDLIVTAGGGIMAHPGGPAAGVEALREAWEAAVAGIPLDAYARERPALRDALG
AAA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcccgtccccgccccgccggcccggatcgaggccgattacctgctggagagcgtc
gtcgacccgcgccgggccgccgagatcatcgcgggcgagcagtcgagcggcaccttcgtg
cccgtcccgggcgagacgcccgagctgaaggcgcgcgccgccgcccggatcgagcgcctc
gacctcctcgacgaggccgtcgccgcgcccgctctgccctccgccggcatcccggccggg
gcggcggcccggcgcgcccgcctcaccctgtcctggcccctcgacaatctcggcccctcg
ctgccgaacctcctcgccacggtggccggcaacctgttcgagctgaagccggtcacgggc
ctgcgcctcctcgacatccgccttccggaggccttcgcgcgggcctatccggggccgcgc
ttcggcgtcgccggcacccgccgcctcgccggaatcgagggccggccgctcatcggcacc
atcatcaagccgagcgtcggcctcgacccgcagcagaccgccgccctggtcgccagcctc
tgcgcgggggggatcgacttcatcaaggacgacgaattgcaggccgacgggccgcactgc
cccttcgacgcgcgggtgcgcgccgtgatgcgggaggtgcgcgcccaccgggaccgcacg
ggccgggccgtgatggtggccttcaacctcaccggcgacctcgaccagatgcgccgccgg
cacgacctgctcgtcgcggagggcgccacctgcctgatggcgagcctcaactccgtcggc
ctcgtcggcatgatcgagctcgggcgcttcagcgccctgccgatccacgcccaccgcaac
ggctggggctacctctcgcgccacccgctgctcggctggtcctacgtggcgtggcagaag
atctggcgcctcgccggcgccgaccacatgcacgtcaacggcctcgccaacaagttcgcg
gagccggacgacagcgtcgtcgcctcggcgcgcacctgcctgacgccgctcttccccgac
aagccctgcctcgccatgccggtcttctcctccggccagtcggtgcggcaggcccccggc
acctaccgggcgctcggcgggaccgacctcatcgtcacggcgggcgggggcatcatggcg
catccgggcgggccggcggcgggcgtcgaagccctgcgcgaggcctgggaggcggcggtg
gcgggcatccccctcgacgcctacgcgcgcgagcgcccggccctgcgcgacgcgctcggg
gccgccgcgtga

DBGET integrated database retrieval system