KEGG   Methylobacterium sp. 4-46: M446_1975Help
Entry
M446_1975         CDS       T00679                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00564  Glycerophospholipid metabolism
met01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    M446_1975
Enzymes [BR:met01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     M446_1975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 NAD_binding_8 FAD_binding_2 AIRS 3HCDH_N FAD_binding_3 HI0933_like GIDA
Motif
Other DBs
NCBI-ProteinID: ACA16440
UniProt: B0UAB9
LinkDB All DBs
Position
complement(2201516..2203045)
Genome map
AA seq 509 aa AA seqDB search
MSLRPEQPGLYDLAVIGGGINGTGIARDAAGRGASVVLFEQGDLAGGTSSASTKLIHGGL
RYLEHREFRLVREALMEREVLWASAPHIVWPLRFVLPHLPGLRPAWLLRLGLFLYDHLGG
RRLLPGTRSLDLARDEAGAPLKAGFRRAFEYSDCWVEDARLVVLNARDAAARGAEIRTRT
RVVAAARGPAHWELTVEAGGRRETVRARILVNAAGPWVSEVLTGVVRANAAAGVRLVQGS
HIVVRRLFRHDRAYIFQNPDGRIVFAIPYERDFTLIGTTDRDYRGDPAAVAASEEEIAYL
CAAASEYFREAIRPQDVVWTYSGVRPLYDDGAGKAQEATRDYVLTLDAGGDRAPLLSVFG
GKITTYRRLAEAALEQLRDHLGAARAPAWTARARLPGGDFPATGYAALAAAIRREYPFLD
PAHAARLVRAYGTEAREILQGASGPADLGRVFGADLTEREVRYLMRREWAVGAEDVLWRR
SKLGLRLSPAEAAALDGFMRGDAAASSAA
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttgagcctgcggcccgagcagcccggcctctacgacctcgccgtgatcggcggcggcatc
aacggcaccggcatcgcccgcgacgcggccggacggggcgcgtcggtcgtgctgttcgag
cagggcgacctcgccggcggcacctcctcggcctccaccaagctgatccacggcggcctc
cgctacctggagcaccgcgagttccgcctcgtgcgcgaggcgctgatggagcgcgaggtg
ctgtgggccagcgccccccacatcgtctggccgctgcgcttcgtcctgccccacctgccc
ggcctgcggccggcctggctcttgcgcctcggcctgttcctctacgaccatctcggcggc
cgcaggctgctgccgggcacgcgcagcctcgacctcgcccgcgacgaggccggcgcgccc
ctcaaggcggggttccggcgggccttcgagtactcggattgctgggtcgaggatgcgcgc
ctcgtcgtgctcaacgcccgcgacgcggccgcccgcggggccgagatccgcacccgcacc
cgggtcgtggcggccgcgcgcgggcccgcgcactgggagctgaccgtcgaggccggggga
cggcgcgagaccgtgcgggcccgcatcctcgtcaacgccgccgggccctgggtgtccgag
gtgctcaccggcgtggtgcgggcgaacgcggcggcgggggtgcgcctcgtccagggcagc
cacatcgtggtgcgccggctcttccggcacgaccgcgcctacatcttccagaacccggac
gggcgcatcgtcttcgcgatcccctacgagcgcgacttcaccctgatcggcaccaccgat
cgcgactaccggggcgaccccgccgcggtcgcggcgagcgaggaggagatcgcctacctg
tgcgccgccgcgagcgagtactttcgcgaggcgatccggccgcaggacgtggtctggacc
tattcgggcgtgcgcccgctctacgacgacggcgccggcaaggcccaggaggcgacgcgg
gactacgtgctgaccctcgacgcgggcggggaccgcgcgcccctgctctcggtcttcggc
ggcaagatcacgacctaccggcgcctcgccgaggcggccctggagcagctgcgcgaccac
ctcggcgccgcccgcgcgcccgcctggacggcgcgggcgcggctgcccgggggcgacttc
ccggcgaccggctacgcggccctggcggcggcgatccggcgcgagtaccccttcctggac
ccggcccacgccgcccggctggtgcgggcctacggcaccgaggcgcgcgagatcctgcag
ggcgccagcggcccggccgatctcggccgggtcttcggggccgacctgaccgagcgcgag
gtgcgttacctgatgcggcgggaatgggcggtcggcgccgaggacgtgctgtggcggcgc
tcgaagctcgggctgcggctcagcccggccgaggcggcggcgctcgacgggttcatgcgc
ggggacgcggccgcgtcctcggcggcctga

DBGET integrated database retrieval system