KEGG   Methylobacterium sp. 4-46: M446_2472Help
Entry
M446_2472         CDS       T00679                                 

Definition
(GenBank) Malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+)), Phosphate acetyltransferase
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00620  Pyruvate metabolism
met00710  Carbon fixation in photosynthetic organisms
met01100  Metabolic pathways
met01120  Microbial metabolism in diverse environments
met01200  Carbon metabolism
Module
met_M00169  CAM (Crassulacean acid metabolism), light
Brite
KEGG Orthology (KO) [BR:met00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M446_2472
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    M446_2472
Enzymes [BR:met01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     M446_2472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: ACA16924
UniProt: B0UI73
LinkDB All DBs
Position
complement(2738270..2740609)
Genome map
AA seq 779 aa AA seqDB search
MSGTISDDLKSGALFYHRNPRPGKLEIQPTKPLGNQRDLALAYSPGVAAACEAIAAEPDE
AATLTSRQNLVAVVSNGTAVLGLGDIGPLAAKPVMEGKAVLFKKFAGIDVFDIEVAEKNV
TKLVDVVAALEPTFGGINLEDIKAPECFEVEEQCRARMNIPVFHDDQHGTAIIVAAAVLN
GLELAGKQLSDARIVTSGAGAAALACLNLLVSLGARRQNITVTDIEGVVYAGRETLMDRW
KAVYAQNTQARTLADVIPGADIFLGLSAGGVLKPEYLDSMAEKPLILALANPYPEIMPNL
AEERRPDAMICTGRSDFPNQVNNVLCFPYIFRGALDVGATTINEEMKAAAVKAIAGLARE
TPSDVVARAYGGEARPFGPHSLIPSPFDPRLILRIAPAVARAAMESGVAKRPLPDIQAYA
ESLDRFVHRSGFIMKPVFTQAKQDPRRVVYAEGEDERVLRAVQAIVEEGLAKPILVGRPN
VVEVRLKRFGLSIRRGTDFELINPDDDPRYRSYVQTYMEAAGRRGVTPDAARTLVRTNAA
VIGALMVRRGEADALICGLEGRFESKLRVIRDIIGLAPGYKDLAALSLIVTAQGAYFLAD
THVRPDPSVAEIADVAIACGDTVRRFGLTPKIALVSHADFGSFDTPSARKMRDALALIRE
RAPELEVDGEMGADTALSQMVRDRVLPNSRLKGEANVLIMPNLDAANIAFQMSKMLANAL
PVGPLLIGPAKPAHILTPSVTARGIVNITAAAVVEAQARCGAVPAAETTAEAGTPLTSE
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgggacgatttcggacgatctcaagagcggcgcgctgttctatcaccgcaatccg
cggcccggtaagctggagatccagcccacgaagccgctcggcaaccagcgcgacctcgcc
ctcgcctactcgccgggcgtcgccgccgcctgcgaggcgatcgcggccgagcccgacgag
gccgccaccctcacctcccgccagaacctcgtcgcggtcgtctcgaacggcaccgcggtg
ctgggcctcggcgacatcggcccgctcgccgccaagccggtcatggagggcaaggcggtc
ctgttcaagaaattcgccggcatcgacgtcttcgacatcgaggtcgccgagaagaacgtc
actaagctggtcgacgtcgtggcggcgctcgagcccaccttcggcggcatcaacctcgag
gacatcaaggcacccgagtgcttcgaggtcgaggagcagtgccgggcgcggatgaacatc
ccggtcttccacgacgaccagcacggcaccgcgatcatcgtggcggcggccgtcctcaac
ggcctcgaactcgccggcaagcagctctcggacgccaggatcgtgacctcgggggcgggc
gcggcggcgctcgcctgcctcaacctgctcgtctccctcggcgcgaggcgccagaacatc
accgtcacggacatcgagggcgtggtctacgcgggccgcgagacgctgatggaccgctgg
aaggcggtctacgcgcagaacacccaggcccgcaccctcgcggacgtgatcccgggcgcc
gacatcttcctcggcctctcggccggcggcgtgctcaagcccgaatacctcgacagcatg
gccgagaagccgctgatcctggcgctcgccaatccctacccggagatcatgccgaacctc
gcggaggagcggcggcccgacgcgatgatctgcaccgggcgctcggattttccgaatcag
gtcaacaacgtcctgtgcttcccctacatcttccggggcgcgctcgacgtcggcgccacc
acgatcaacgaggagatgaaggccgccgccgtgaaggcgatcgcgggtctcgcgcgcgag
accccctcggacgtggtggcccgcgcctatggcggcgaggcgcggcccttcggcccgcac
tcgctgatcccgagcccgttcgacccgcggctgatcctgcgcatcgccccggcggtcgcg
cgggcggcgatggaatcgggcgtcgcgaagcggccgctgccggacatccaggcctacgcc
gagtcgctcgaccgcttcgtccaccgctccggcttcatcatgaagccggtcttcacccag
gcgaagcaggatccccgccgggtcgtctacgccgagggcgaggacgagcgggtgctgcgc
gccgtgcaggcgatcgtcgaggaggggctcgccaagccgatcctggtcggacgcccgaac
gtggtcgaggtgcgcctcaagcgcttcggcctctcgatccgccgcggcacggatttcgaa
ctcatcaacccggacgacgacccgcgctaccgcagctacgtccagacctacatggaggcg
gcgggacggcgcggggtcacgccggacgcggcccggacgctcgtgcgcaccaacgccgcg
gtgatcggcgccctgatggtgcggcggggcgaggcggacgcgctgatctgcgggctggag
ggtcggttcgagagcaagctgcgggtgatccgcgacatcatcggcctcgcccccggctac
aaggacctggcggcgctgagcctgatcgtgacggcccagggcgcctacttcctggccgac
acccacgtgcgcccggacccgagcgtcgccgagatcgccgacgtcgcgatcgcctgcggc
gacacggtgcggcgcttcggcctcaccccgaagatcgccctggtgagccacgcggatttc
ggctccttcgacaccccctcggcgcgcaagatgcgcgacgcgctggcgctgatccgcgag
cgggcgcccgagctcgaggtggacggcgagatgggggccgacaccgccctgtcgcagatg
gtgcgcgacagggtgctgccgaactcgcgcctgaagggcgaggcgaacgtgctgatcatg
ccgaatctcgacgcggccaacatcgccttccagatgtccaagatgctggccaacgccctg
ccggtcggccccctgctgatcggcccggccaagcccgcccacatcctcacgccctccgtg
acggcccgcggcatcgtcaacatcacggccgccgccgtggtcgaggcgcaggcccgctgc
ggcgcggtgcccgcggccgagaccaccgccgaggccggcacgccgctcacctccgagtga

DBGET integrated database retrieval system