KEGG   Methylobacterium sp. 4-46: M446_2875Help
Entry
M446_2875         CDS       T00679                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
met  Methylobacterium sp. 4-46
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Acyltransferase PP-binding
Motif
Other DBs
NCBI-ProteinID: ACA17297
UniProt: B0UID5
LinkDB All DBs
Position
3193553..3196429
Genome map
AA seq 958 aa AA seqDB search
MPEVALPEVALQNVTPQAGDPAERHREPTAADVLEVIRSLLLELHPERRRSPAVDLDSDL
ERDLGLDSLGRAELLLRLSRRFRILLPERLIGEASTPDDLLAALRSAGAAPRPGAVPSRT
EALPPASEPHRAETWPEVLAFHVRHHPDRPHLRLREGPDAETVLTYADLDRRARRVAAGL
LGHGLAPGDRVAIMLPTGPDFFPAFFGCLLAGGVPVPLYPPFRRAQVQDHLERQAGILTN
AAPGILITDSAVAPFARLLPDRVEGLRVLTTAADLADAEPLAEPVPATGASLALIQYTSG
STGDPKGVTLTHANLLANVRAMGEALGASSADVVVSWLPLYHDMGLIGCWLGSLYFGAPA
VILPPLAFLADPGSWLWAIHRHRGTISAAPNFAYELCLKSLRDEDVAGLDLGSLRVLTNG
AEPVSPDTLARFARRFGAFGLQTSALTPVYGLAECAVGLAFPPLGRGPRIDWIDRAALSR
EGTARPAPPGEAGSTAFAACGRPLRGHQIRIVDEAGRELPERREGRLQFRGPSATAGYFR
KPEATRVLFAGDWLESGDLAYMAGGDVYVTGRTKDIVIRAGRKIHPHELEEAAGAVEGVR
KGCVAAFACPDPKTGTERLILAAETRLTDAPALADLRRALARAAGAVLDQPPDEILLCAP
HSVPKTSSGKIRRAAARALYEAGELGRAQPALRAQLAGLAVAGIAARLRRIGRLWSDACY
AALWWGVLGGLGAVLWLLVLVLPNRTWRYAALRAGSRAFFRLTGTPLAVEGRPMARAAIV
VANHASYLDAAVLAAVLPGTPVFLAKHELARQRVAGPFLRRLGTAFVHRGTAEGVAETQQ
VLARVRAGEQLVAFPEGTFTRNPGLLGFHLGAFLDACRADIPVVPVAITGTRSLLRADQW
FPRRGAVGVQFGEPIAPDGSDFHAAIRLRDRARAAILARCGEPDLADESVIPSAPPTA
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
ttgccggaggtcgccttgccggaagtcgccttgcagaacgtaacccctcaggcgggtgat
ccggccgagcggcatcgcgagccgaccgcggcggacgtcctcgaggtgatccggtctctc
ctgctcgaactgcatcctgagcgccgccgctccccggccgtggacctcgacagcgacctc
gagcgggatctcggcctcgacagcctcggccgcgcggagctcctgctgcgcctctcgcgc
cgcttccggatcctgctgccggagcggctcatcggcgaggcctccacgccggacgacctg
ctcgcggccctccggtccgccggtgcggcgccccgtccgggggccgtgccgtcccgcacc
gaggccctccccccggcatccgagccgcaccgggccgagacttggcccgaggtgctcgcc
ttccacgtccgccaccatccggaccggccccacctgcgccttcgtgaggggcccgacgcc
gagaccgtcctcacctacgcggacctcgaccggcgggcgcgccgcgtcgcggccggcttg
ctcggccacggcctcgcacccggcgaccgggtcgccatcatgctgccgaccggacccgac
ttcttcccggctttcttcggctgccttctcgcgggcggtgtcccggtgccgctctatccg
ccgttccggcgcgcccaggtccaggaccacctcgagcgccaagccggcatcctgacgaat
gccgcccccgggatcctgatcaccgattcggcggtcgcacccttcgcccggctgctgccg
gaccgcgtcgagggattgcgggtgctgacgaccgcggcggacctcgccgacgcggagccc
ctggccgagcccgtgccggcgacgggcgcgagcctcgcgctgatccagtacacctccggc
agcaccggcgatccgaagggcgtgacgctgacgcacgccaacctgctcgccaatgtccgc
gccatgggcgaggcgctcggcgcctcctcggcggacgtcgtggtgagctggctgccgctc
taccacgacatggggctgatcggctgctggctgggaagcctctacttcggcgcgcccgcc
gtgatcctgccgcccctggccttcctggccgatcccggaagctggctgtgggcgatccac
cggcaccgcgggacgatctccgccgctccgaacttcgcctacgagctctgcctcaagagc
ctgcgcgacgaggatgtcgcgggactcgacctcggctccctgcgcgtcctcaccaacggc
gccgagccggtgagccccgacaccctggcgcggttcgcccggcgcttcggcgccttcggc
ctgcagacctccgccctcaccccggtctacggcctcgccgaatgtgcggtcggactggcc
ttcccgccgctcggacgggggccgcgcatcgactggatcgaccgcgcggcgctgtcgcgc
gagggaaccgcgcgccccgccccgcccggcgaggcggggtcgaccgccttcgcggcctgc
gggcgcccgttgcgcggccaccagatccgcatcgtggacgaggccggacgcgaactgccc
gagcggcgggagggccgcctccagttcagggggccgtccgccacggccggctacttccgc
aagccagaggccacgcgcgtcctgttcgccggagactggctggagagcggcgacctcgcc
tacatggcgggcggcgacgtctacgtcacggggcgcaccaaggacatcgtcatccgggcg
ggacggaagatccatccgcacgaactcgaagaggccgcgggcgcggtcgagggggtgagg
aagggctgcgtcgcggccttcgcctgccccgacccgaagaccgggacggagcggctgatc
ctcgccgccgagacgcggctgacggacgcgccggccctggcggacctgcgccgcgccctc
gcccgggccgccggggcggtgctcgatcagccccccgacgagatcctgctgtgcgcgccc
cactcggtccccaagacgtcgagcgggaagatccggcgcgcggcggcgcgggcgctctac
gaggcgggcgaactcggccgggcgcagcccgctctccgggcgcagctcgcggggctcgcc
gtcgccggcatcgcggcgcggctgcgccggatcggccgcctctggtcggacgcgtgctac
gcggccctgtggtggggcgtgctcggggggctcggcgccgtcctgtggctcctcgtcctc
gtcctcccgaaccgcacgtggcgctacgccgcgctgcgcgcgggatcgcgcgccttcttc
cgcctcaccgggacacccctcgccgtcgagggcaggccgatggcgcgtgccgccatcgtg
gtggcgaaccacgcgagctacctcgacgcggccgttctggccgccgtcctgcccgggaca
ccggtcttcctcgccaagcacgaactggcgcgccagcgcgtcgccggacccttcctgcgg
cggctgggaacggccttcgtgcatcgcggcaccgccgaaggcgtcgcggagacgcagcag
gtccttgcgcgcgtccgggcgggcgagcagctggtcgccttcccggagggtaccttcacc
cggaacccgggcctcctcggcttccatctcggcgccttcctggatgcgtgccgggccgac
atcccggtcgtgccggtcgcgatcaccggcacccggtcgctgctgcgcgccgaccagtgg
ttcccgcgccgcggcgccgtcggggtgcagttcggcgagccgatcgcacccgacggcagc
gacttccacgccgccatccgcctgcgcgaccgggcgcgcgcggcaatcctggcgcggtgc
ggcgaaccggatctggccgacgagtccgtgattccctccgcaccgcccacggcctga

DBGET integrated database retrieval system