KEGG   Methylobacterium sp. 4-46: M446_2967Help
Entry
M446_2967         CDS       T00679                                 

Definition
(GenBank) uncharacterized membrane-anchored protein
Organism
met  Methylobacterium sp. 4-46
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3422
Motif
Other DBs
NCBI-ProteinID: ACA17379
UniProt: B0UJW5
LinkDB All DBs
Position
3291669..3292952
Genome map
AA seq 427 aa AA seqDB search
MRLNEHALRARVLAEVHARPFMPVKTPRRFLHYAFLTDGEAAAADRAALDAYCAGLGLPG
PPAAAKQHRVVFSGAILRWESHSEFTTYTWEYADQQGLAFQPQPDALAGPMEGLPQPGDL
LVAVDLHLLAAGEGDVPPEITATFSPSSLAVAQAEGGAAVIATDFQADPHGFVRVVVADR
GMTRVAAGALVQRVLEIETYRTLALLGLPEAQALGPAIRRIETALPVLMEEMRASEGFEA
NHQLLDRLIALSAELEAGAARSLFRFGATRAYDELIRLRLDAIREQPIPGQTSWSVFLAR
RFNPAIRTCMATGERQDTLSEKLSRAAQMLRTRVDVELEKQNHAQLQAMNDRVRLQIRLQ
QTVEGLSVAAISYYVASLVHHVLEGAHAAGLPVDATIGTAAAVPAIVLAVAWTVRRIRRR
HAEGEAG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgaacgaacatgccctgcgggcgcgggtgctggcggaggtgcatgcccggccc
ttcatgccggtgaagaccccgcggcgcttcctgcactacgccttcctgacggatggcgag
gcggcggcggcggaccgggccgcgctcgacgcctattgcgccggcctcggcctgccgggg
cccccggcggcggccaagcagcaccgggtggtcttctcgggggcgatcctgcgctgggag
agccacagcgagttcaccacctacacctgggaatacgcggaccagcagggtctcgccttc
cagccgcagcccgacgcgctcgccgggccgatggagggcctgccgcagccgggcgacctg
ctcgtcgccgtcgacctccacctgctcgcggccggcgagggcgacgtgccgccggagatc
accgcgaccttctcgccctcctccctggcggtcgcccaggcggagggcggcgcggccgtc
atcgccaccgacttccaggccgacccgcacggcttcgtgcgcgtcgtcgtggcggatcgc
ggcatgacccgggtggcggccggcgccctggtgcagcgcgtcctggagatcgagacctac
cgcaccctggccctgctcggcctgcccgaggcgcaggcgctcggcccggcgatccgccgg
atcgagaccgccctgccggtgctgatggaggagatgcgggcgagcgaggggttcgaggcc
aaccaccagctcctcgaccggctgatcgcgctctcggccgagctcgaggccggggcggcc
cgctcgctcttccgcttcggtgccacccgggcctacgacgagctgatccgcctgcgcctc
gacgccatccgcgagcagccgatccccggccagacgagctggtcggtcttcctcgcccgg
cgcttcaacccggcgatccgcacctgcatggccacgggcgagcggcaggacacgctctcc
gagaagctctcgcgcgccgcccagatgctgcgcacccgggtcgacgtcgaactggagaag
cagaaccacgcccagctccaggcgatgaacgaccgggtgaggctgcagatccggctgcag
cagaccgtcgagggcctctcggtcgcggcgatcagctactacgtggcgagcctcgtccat
cacgtgctggagggcgcgcacgcggcggggctccccgtcgacgccacgatcgggaccgcg
gccgcggtgccggcgatcgtgctcgcggtcgcctggacggtccggcgcatccggcgccgg
cacgccgagggcgaggccggctga

DBGET integrated database retrieval system