KEGG   Methylobacterium sp. 4-46: M446_4557Help
Entry
M446_4557         CDS       T00679                                 

Definition
(GenBank) conserved hypothetical protein
Organism
met  Methylobacterium sp. 4-46
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACA18898
UniProt: B0UQR2
LinkDB All DBs
Position
complement(5014327..5014947)
Genome map
AA seq 206 aa AA seqDB search
MSRALLPVLALSLLSAAPALAKPRPKAEKPESAAPASLQASPVGSFGAWNVFAAGEGKGR
ICYAISKPQARLPKSLKRDDAFLFVTVRRGERVANEVAIMMGFAPKPGSNQTGAGADTAA
ANAAVPAPSAANDPSLAIGSARYALVVKGTNAWLQNPAEEGRVVTEMGRGKKVVVKAVSQ
RGNASTDEYNLEGFGDAIKRTREECK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtgccctcctccccgtcctcgccctctccctcctgtccgcggcgcccgcgctg
gcgaagccgaggcccaaggccgagaagcccgaatccgccgcgcccgcgagcctgcaggcg
agcccggtcggcagcttcggggcctggaacgtcttcgccgcgggcgagggcaagggccgc
atctgctacgcgatcagcaagccgcaggcgcggctgcccaagagcctcaagcgcgacgac
gccttcctgttcgtgaccgtgcgcaggggcgagcgggtggccaatgaggtcgccatcatg
atgggcttcgccccgaagcccggcagcaaccagaccggagccggggccgacaccgcggcg
gcgaacgccgccgtcccagccccctcggccgccaacgacccgtcgctggcgatcggctcg
gcccgctacgcgctcgtggtgaagggcaccaatgcctggctgcagaacccggccgaggag
ggccgcgtcgtcaccgagatggggcgcggcaagaaggtcgtcgtgaaggcggtgtcgcag
cgcggcaacgcctcgaccgacgagtacaacctcgaaggcttcggcgacgccatcaagcgc
acccgcgaggagtgcaagtag

DBGET integrated database retrieval system