KEGG   Methylobacterium sp. 4-46: M446_4569Help
Entry
M446_4569         CDS       T00679                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00620  Pyruvate metabolism
met00680  Methane metabolism
met00710  Carbon fixation in photosynthetic organisms
met01100  Metabolic pathways
met01120  Microbial metabolism in diverse environments
met01200  Carbon metabolism
Module
met_M00168  CAM (Crassulacean acid metabolism), dark
met_M00346  Formaldehyde assimilation, serine pathway
Brite
KEGG Orthology (KO) [BR:met00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M446_4569
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    M446_4569
   00680 Methane metabolism
    M446_4569
Enzymes [BR:met01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     M446_4569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase GvpK
Motif
Other DBs
NCBI-ProteinID: ACA18910
UniProt: B0UQS4
LinkDB All DBs
Position
5023094..5025919
Genome map
AA seq 941 aa AA seqDB search
MYRPEETPDSPAAPESLEADLLQLVEQARQQASEDPFRNPVLTVALAISRRMDRGEVSEA
DLEPLFRSLRGQALEERAQRLRAYLGLDQEGGDDLARAVPLILGEESDFEVARARIERPR
FAAVFTAHPTFGMPKAVARLLAEAASTPAPEGRRALLGEAAGLSSRPDPVITLNDEFDQA
RFSVQHGRAALDGLNEALLRAARERWPEHWHDLVPQPVVIASWVGCDTDGRTDIGWWDTL
RYRLESKRTQFERVLAQLPEDPAAVPVRRLAEAARDAVSRQLAVAPKLGDDPSLEVVHRF
ALALIIERERAQTEAGPLLSALGAAIAATRDEEARLRLCVLRAGCAAHGLQNGLPHFRLN
ATQVHNAVRRSLDREGDPTDPAQRRSHLASINALLDHVEAVPVDFGALAAERSSASRLMM
TIAQILKHVDGTHPVRFLIAETETGYTLLAALWLAEHFGIGDKVEITPLFETASALEQGV
HVVEDALRSAHWRRYLRRIGRLVLQFGYSDSGRYVGQLAATFWIERLRLRITEMMVANGL
ADIELVIFDTHGESIGRGAHPASLRDRLAYLAPSQARLRNREAGLKVRLESSFQGTDGYL
LFGSAPLARATVLRIVEHVFEAGDPPPDPIYAEPDFATEFFTGARQDMETLVDDPGYAAL
LGTFGPNLIDRTGSRPVARQSDAGGPVAITHPRQIRAIPNNAILQQLGFLANSMHGVGHA
AARAPDLFGEMRAESERFRRAFSLVQHAARVSDLDVLRAYIETLDPGMWLERARRATRDG
RREEIIAIAGALDRLNLAPRLRRLFGRLTHDHLMLHSVARDLAAMSLRLTLLHALRLALI
HRIWFLAVHIPGFRPQAGVTRESLIERILRLDVPGCLKALDEIFPVTPDPTLGLNFGEPA
GPRGVGTYETEHRTLFEPIGRLFAQVREISGMIQHEVGAFG
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atgtaccggcccgaggaaacccccgactcgcccgccgctcccgagagcctggaggcggac
ctgctccagctggtggagcaggcccggcagcaggcgagcgaggacccattccgcaacccc
gtcctcaccgtggccctcgcgatcagccgccgcatggaccggggcgaggtgagcgaggcg
gacctcgaaccgctcttccgctccctgcgcgggcaggccctggaggagcgggcgcagcgc
ctgcgcgcctatctgggcctcgaccaggagggcggcgacgacctcgcccgcgcggtgccg
ctgatcctcggcgaggagagcgacttcgaggtggcccgggcccggatcgagcgaccgcgc
ttcgcggcggtcttcaccgcgcacccgaccttcggcatgcccaaggcggtggcccgcctg
ctcgccgaggccgcctcgacgccggccccggaaggccggcgggccctgctcggcgaggcg
gcggggctgtcctcccgccccgacccggtcatcaccctcaacgacgagttcgaccaggcc
cgcttctcggtgcagcacgggcgcgccgccctcgacgggctgaacgaggccctgctgcgg
gccgcccgcgagcgctggcccgagcactggcacgacctggtgccgcagccggtcgtgatc
gcctcctgggtcggctgcgacacggacgggcgcaccgatatcggctggtgggacacgctg
cgctaccggctggaatcgaagcgcacgcaattcgagcgggttctggcgcagctcccggag
gatccggccgccgtcccggtgcggcggctcgcggaggcggcccgcgacgcggtgtcgcgc
cagctcgccgtcgcccccaagctcggcgacgatccgagcctggaggtggtgcaccgcttc
gccctcgcgctgatcatcgagcgcgagcgcgcccagaccgaggcgggcccgctgctctcc
gccctcggcgcggcgatcgcggcgacgcgcgacgaggaggcgcggctcaggctctgcgtc
ctgcgcgccggctgcgccgcgcacgggctgcagaacgggctgccgcatttccggctcaac
gccacccaggtccacaacgcggtgcgccgctccctcgaccgggagggcgacccgaccgac
ccggcccagcgccgctcgcacctcgcctcgatcaacgcgctcctcgaccacgtcgaggcg
gtgccggtggatttcggcgcgctcgccgccgagcgctcctccgcctcccgcctgatgatg
acgatcgcccagatcctcaagcacgtggacggcacccatccggtgcgcttcctgatcgcc
gagaccgagaccggctacacgctcctcgccgcgctctggctcgccgagcatttcggcatc
ggcgacaaggtcgagatcacgccgctcttcgagaccgcctcggccctggagcagggcgtg
cacgtcgtcgaggacgcgctgcgctccgcccattggcggcgctacctgcgccggatcggc
cgcctcgtgctgcaattcggctactcggattccggccgctacgtcggccagctcgccgcc
accttctggatcgagcggttgcgcctgcgcatcaccgagatgatggtcgcgaacggcctc
gccgacatcgagctcgtgatcttcgacacgcacggcgagtcgatcggccgcggcgcccat
ccggcgagcctgcgcgaccgcctcgcctacctcgccccgagccaggcgcgcctgcgcaac
cgcgaggcggggctgaaggtgcggctcgaatcgagcttccagggcacggacggctacctg
ctgttcggctccgcgccgctcgcgcgcgccaccgtgctgcgcatcgtcgagcacgtcttc
gaggcgggcgatcccccgcccgatccgatctacgccgagcccgacttcgccaccgagttc
ttcaccggcgcccggcaggacatggagacgctggtcgacgatcccggctacgcggccctg
ctcggcaccttcgggccgaacctgatcgaccgcaccgggtcgcggccggtggcgcgccag
tccgacgcgggcggcccggtcgcgatcacccatccacggcagatccgggcgatccccaac
aacgccatcctgcagcagctcggcttcctggcgaattcgatgcacggggtcggccacgcc
gccgcccgggccccggacctgttcggcgagatgcgggcggagtccgagcgcttccggcgc
gccttcagcctcgtccagcacgccgcccgggtcagcgacctcgacgtgctgcgcgcctac
atcgagacgctcgatcccggcatgtggctggaacgggcgcggcgggcgacgcgcgacggg
cggcgggaggagatcatcgccatcgcgggtgccctcgaccggctgaacctcgccccgcgc
ctgcgccggctgttcgggcgcctgacccacgaccacctgatgctgcactcggtggcgcgc
gacctcgccgcgatgagcctgcggctgaccctgctgcacgcgctccggctcgcgctgatc
catcggatctggttcctggccgtgcacatcccgggcttccggccgcaggccggcgtcacc
cgcgagagcctgatcgagcgcatcctgcggctcgacgtgccgggctgcctgaaggcgctg
gacgagatcttcccggtgacgccggacccgacgctcggcctgaatttcggcgagccggcc
gggccgcgcggggtcggcacctacgagacggagcaccggaccctgttcgagccgatcggc
cgcctcttcgcgcaggtgcgcgagatcagcggcatgatccagcacgaggtcggggccttc
ggctga

DBGET integrated database retrieval system