KEGG   Methylobacterium sp. 4-46: M446_4826Help
Entry
M446_4826         CDS       T00679                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:met00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    M446_4826
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:met02000]
    M446_4826
Enzymes [BR:met01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     M446_4826
Transporters [BR:met02000]
 Other Transporters
  Pores ion channels [TC:1]
   M446_4826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C_2 GST_N_3 GST_C GST_N_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: ACA19156
UniProt: B0UCR9
LinkDB All DBs
Position
complement(5303853..5304488)
Genome map
AA seq 211 aa AA seqDB search
MNADRVTLYHSPNTRSSSALLLLEELGAPYDLQVLNMKAGENRQPAYLAVNPMGKVPAIR
HRGALVTEQVAVFLYLADAFPEAGLAPAIGDPLRGPYLRWMVYYGSSFEPAVVDKARGLA
SDESVRAMLPYGSYEAALAVVNDQLRQGPYLLGERFTAADILWGAALTWTTMFGFVPETP
EIAAYVARHQARPAVARVRERDAALAAAQAA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcggaccgcgtcacgctctaccactcgccgaacacgcgctcgtcgagcgccctg
ctgctgctggaggagctgggcgccccctacgacctccaggtgctcaacatgaaggcgggg
gagaaccggcagccggcctacctggcggtcaatccgatggggaaggtcccggccatccgt
catcgcggcgcgctggtcaccgagcaggtcgcggtgttcctgtacctcgccgacgccttc
ccggaggcgggcctcgccccggcgatcggcgatcccctgcgcggaccctacctgcgctgg
atggtctattacggcagcagcttcgaaccggcggtggtcgacaaggcgcgcgggctcgcc
tcggacgagtccgtccgcgcgatgctgccctacggcagctacgaggccgcgctcgcggtg
gtgaacgaccagctccgccaggggccctacctcctgggcgagcgcttcacggccgccgac
atcctctggggggcggcgctcacctggacgacgatgttcggattcgtgcccgagacgccg
gagatcgccgcctacgtggcgcgccaccaggcgcgcccggccgtggcgcgggtgcgcgag
agggacgcggccctcgccgccgcgcaggccgcctga

DBGET integrated database retrieval system