KEGG   Methylobacterium sp. 4-46: M446_5836
Entry
M446_5836         CDS       T00679                                 

Definition
(GenBank) dTDP-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00521  Streptomycin biosynthesis
met00523  Polyketide sugar unit biosynthesis
met00525  Acarbose and validamycin biosynthesis
met01100  Metabolic pathways
met01110  Biosynthesis of secondary metabolites
Module
met_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:met00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    M446_5836
   01055 Biosynthesis of vancomycin group antibiotics
    M446_5836
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    M446_5836
   00525 Acarbose and validamycin biosynthesis
    M446_5836
Enzymes [BR:met01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     M446_5836
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 3Beta_HSD adh_short NAD_binding_10 KR
Other DBs
NCBI-ProteinID: ACA20123
UniProt: B0UGC6
LinkDB
Position
6415015..6416067
AA seq 350 aa
MRILVTGGCGFIGSALVLHLVRDLGHEVLTLDALTYAANPISLLPLRDEPRHRLVQADIC
EPERVAALFAEFRPEAVMHLAAESHVDRSITGPAAFIRTNVVGTQVMLEAARAHHAGLPA
DGQARFRFLHVSTDEVYGSLPPGGFFTEESRYDPRSPYSASKAASDHLARAWHETYGLPV
LVTNCSNNYGPRHFPEKLIPLMILNALEGKALPVYGDGQNERDWIHVEDHARGLVAVLER
GRIGETYLLGGRAVRSNLSVVRTLCAIFDRLRPEAGPHERLISFVTDRPGHDRRYAIDPS
KAEAELGWRPTRSFDQALEETVRWYLDHREWWQPIREGRYAGERLGLTAA
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgcgcatcctcgtcacgggcggctgcggcttcatcggctcggcgctcgtcctccacctc
gtccgcgacctcggccacgaggtgctcaccctcgacgccctcacctacgcggccaacccg
atctcgctcctgccgctcagggacgagccccgccaccggctcgttcaggccgacatctgc
gagcccgagcgcgtcgccgcgctcttcgcggagttccggcccgaggcggtgatgcacctc
gccgccgagagccacgtcgaccgctcgatcaccggaccggccgccttcatccgcaccaac
gtggtcggcacccaggtcatgctcgaggccgcccgcgcccaccatgccggcctgcccgcg
gacgggcaggcgcgcttccgcttcctccacgtctccaccgacgaggtctacggctcgctg
cccccgggcggcttcttcaccgaggagagccgctacgacccccgctcgccctactcggcc
tccaaagccgcctccgaccacctcgcccgggcctggcacgagacctacggcctgccggtg
ctcgtcaccaactgctcgaacaattacgggccgcgccacttccccgagaagctgatcccg
ctgatgatcctcaacgcgctggagggcaaggcgctgccggtctacggcgacgggcagaac
gagcgcgactggatccacgtcgaggaccacgcgcgcggcctcgtcgcggtgctggagcgg
ggccggatcggcgagacctacctgctcggcggccgcgcggtgcgcagcaacctttcggtg
gtgcgcacgctctgcgcgatcttcgaccggctgcggcccgaggccggcccgcacgagcgg
ctgatcagcttcgtgaccgaccgtcccggccacgaccggcgctacgcgatcgacccgagc
aaggccgaagccgaactcggctggcgcccgacccggagtttcgatcaggcgctggaggag
acggtccgctggtacctcgaccaccgcgagtggtggcagccgatccgcgagggccgctac
gcgggcgagcgcctcggcctgacggcggcgtga

DBGET integrated database retrieval system