KEGG   Methylobacterium sp. 4-46: M446_5880Help
Entry
M446_5880         CDS       T00679                                 

Definition
(GenBank) valyl-tRNA synthetase
  KO
K01873  valyl-tRNA synthetase [EC:6.1.1.9]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:met00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    M446_5880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:met01007]
    M446_5880
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:met03016]
    M446_5880
Enzymes [BR:met01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.9  valine---tRNA ligase
     M446_5880
Amino acid related enzymes [BR:met01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   M446_5880
Transfer RNA biogenesis [BR:met03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    M446_5880
 Prokaryotic type
    M446_5880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g Val_tRNA-synt_C tRNA-synt_1_2 tRNA-synt_1f tRNA-synt_1e ABC_tran_CTD
Motif
Other DBs
NCBI-ProteinID: ACA20167
UniProt: B0UHI6
LinkDB All DBs
Position
6465583..6468294
Genome map
AA seq 903 aa AA seqDB search
MMDKTFDPAAVEARIAAEWEEAQAFRAGRPDRADAAPYSIMIPPPNVTGSLHMGHALNNT
LQDVLARFERLRGKDVLWQPGTDHAGIATQMVVERRLAEHQQPDRRALGRAEFVRRVWAW
KAESGGTIVNQLKRLGASCDWSRERFTMDEGLSKAVVKVFVDLHAAGLIYRDKRLVNWDP
RFQTAISDLEVQQVEVKGHLWHFAYPVVDQEGRETGETITVATTRPETMLGDAAVAVHPE
DERYRALIGRTVRLPLVGRLIPIVADSYSDPEKGTGAVKITPAHDFNDFEVGRRHGLPLI
NVLDQEARITLDGNEAFLENASPEPEALALHGLDRAEARKAVVALMEARGRLVAVEPNTH
AVPHGDRSGVVIEPYLTDQWYLDVKPLADRAMQAVRDGRTRFVPEAYEKTYFQWLEHIEP
WCISRQLWWGHQIPAWYDPDGNVFVAGSEEEALEKAAARHGRPVALRRDEDVLDTWFSSG
LWPFSTLGWPEATPELARYYPTSTLVTGFDIIFFWVARMMMMGLHALGEVPFRTVYIHAL
VRDEKGAKMSKSKGNVVDPLDLVDRYGADALRFTLAAMAAQGRDIKLSVQRVEGYRNFAT
KLWNAARFAEMNGCRIAPDFRPEAARETLNAWALGEAARAVAEVTAALDAFRFNDAAAAA
YRFVWNVFCDWYLELAKPVLQGEAGPAQDETRATVAFLIDQICILLHPFMPFLTEELWAT
KGREAGLERGLLALGRWPDLGRLGRPEAEAEIGWVVDLVSEIRSARSETNVPAGAQIPLV
LVDPSEAVRARLGRWGETIRRLGRIGEIGAVAESPAKAVQLLVRGEVAALPLEGVVDLAA
EVARLRKEEGKLEGEIGKIDAKLANADFLARAPEEVVEEQRERREAAAERLAKVREALAR
LEG
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgatggacaagaccttcgatcccgccgccgtcgaggcgcgcatcgccgccgagtgggag
gaggcgcaggccttccgggccggccggcccgaccgcgccgacgccgccccctacagcatc
atgatcccgccgccgaacgtgacgggctcgctgcacatgggccacgccctcaacaacacc
ctgcaggacgtgctcgcccgcttcgagcgcctgcgcggcaaggacgtgctctggcagccc
ggcaccgaccatgccggcatcgccacccagatggtggtggagcgccgcctcgccgagcac
cagcagcccgaccggcgcgccctcggccgcgccgaattcgtgcgccgggtctgggcgtgg
aaggcggaatccggcggcaccatcgtcaaccagctcaagcggctcggcgcctcctgcgac
tggtcgcgcgagcgcttcaccatggacgaggggctctcgaaggccgtcgtcaaggtcttc
gtcgacctgcacgcggcggggctgatctaccgcgacaagcgcctcgtgaactgggacccg
cggttccagaccgcgatctcggacctggaagtgcagcaggtcgaggtgaagggccatctc
tggcacttcgcctacccggtcgtggaccaggagggacgggagaccggcgagaccatcacg
gtggcgacgacgcggcccgagaccatgctgggcgacgcggccgtggcggtgcaccccgag
gacgagcgctaccgggccctcatcggccggacggtgcgcctgcccctcgtcggccgcctg
atcccgatcgtggcggacagctactccgaccccgagaagggcaccggcgcggtcaagatc
accccggcccacgacttcaacgacttcgaggtcgggcgccggcacgggctgccgctcatc
aatgtcctggatcaggaagcccgcataaccctcgacggcaacgaggcgttcctcgagaac
gcgtcccccgagccggaggcgctcgccctgcacggcctcgaccgcgcggaggcccgcaag
gcggtggtcgcgctgatggaggcgcgcgggcggctcgtcgcggtcgagcccaacacccac
gcggtgccgcacggcgaccgctcgggggtggtcatcgagccctacctcaccgaccaatgg
tacctggacgtgaagccgctggccgaccgcgccatgcaggcggtgcgcgacggccgcacc
cgcttcgtgcccgaggcctacgagaagacctacttccagtggctggagcacatcgagccc
tggtgcatctcgcgccagctctggtggggccaccagatcccggcctggtacgatccggac
ggcaacgtcttcgtggcggggagcgaggaggaggccctggagaaggccgccgcccggcac
ggccgcccggtcgccctgcgccgcgacgaggacgtgctggacacgtggttctcctcgggc
ctgtggcccttctcgacgctgggctggcccgaggcgacgccggaactcgcccgctactac
ccgaccagcaccctggtgacggggttcgacatcatcttcttctgggtcgccaggatgatg
atgatgggccttcacgcgctgggcgaggtgccgttccggaccgtctacatccacgccctc
gtgcgcgacgagaagggcgccaagatgtcgaagtccaagggcaacgtggtcgatcccctc
gacctcgtcgaccgctacggcgccgacgccctgcgcttcaccctcgcggccatggcggcg
caggggcgcgacatcaagctctcggtgcaacgcgttgagggatatcggaacttcgccacg
aagctgtggaacgcggcccgcttcgccgagatgaatggctgccggatcgcgccggatttc
cgccccgaggcggcgcgcgagaccctgaacgcctgggcgctcggcgaggccgcccgcgcg
gtggcggaggtgacggcggcgctcgacgccttccggttcaacgacgccgcggccgccgcc
taccgcttcgtgtggaacgtcttctgcgactggtacctcgaactcgccaagcccgtgctg
caaggcgaggccggcccggcgcaggacgagacccgcgccaccgtggccttcctgatcgac
cagatctgcatcctgctccatcccttcatgcccttcctgacggaggagctctgggcgacg
aagggccgggaggcggggctggagcgcgggctcctggcgctcgggcgctggccggatctc
gggcgcctgggccggccggaggccgaggccgagatcggctgggtggtcgacctcgtctcg
gagatccgctcggcccgctcggagacgaacgtgccggccggcgcccagattcccctcgtg
ctggtcgacccgagcgaggcggtgcgggcgcgcctgggccgctggggcgagaccatccgg
cgcctcgggcggatcggcgagatcggcgccgtcgccgagagcccggccaaggcggtccag
ctgctggtgcgcggcgaggtggcggccctgcccctggagggcgtggtcgacctcgccgcc
gaggtggcgcgcctgcgcaaggaggagggcaagctggagggggagatcggcaagatcgac
gccaagctcgccaatgccgacttcctggcccgcgcccccgaggaggtggtcgaggagcag
cgcgagcgccgcgaggccgccgcggagcgcctcgccaaggtgcgcgaggccctggcccgg
ctggagggatag

DBGET integrated database retrieval system