KEGG   Methylobacterium sp. 4-46: M446_5900Help
Entry
M446_5900         CDS       T00679                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00010  Glycolysis / Gluconeogenesis
met00020  Citrate cycle (TCA cycle)
met00620  Pyruvate metabolism
met01100  Metabolic pathways
met01110  Biosynthesis of secondary metabolites
met01120  Microbial metabolism in diverse environments
met01130  Biosynthesis of antibiotics
met01200  Carbon metabolism
Module
met_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:met00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M446_5900
   00020 Citrate cycle (TCA cycle)
    M446_5900
   00620 Pyruvate metabolism
    M446_5900
Enzymes [BR:met01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     M446_5900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ACA20185
UniProt: B0UHK4
LinkDB All DBs
Position
6487890..6489329
Genome map
AA seq 479 aa AA seqDB search
MPINVLMPALSPTMEKGNLAKWLKKEGDPVKSGDVLAEIETDKATMEVEAVDEGVLARIV
VPEGTADVPVNDLIAVIAAEGEDPARVGAGEGAAQGAAKGAAPPPRDEDRTEGGASLAYA
RVNEAPDAAKAAANGAAAKPNGAAPGGAPQGAAPAGGRILASPLARRIAKQEGIDLSRVR
GSGPHGRVIERDVRAALKEGPAPAAPAGAPAAAPGGATPPAAKPAAGAPAASGLTGDQVK
AMFERGSYEEVPLDGMRRTIAKRLVESKQTVPHFYLSLDCELDALLALREQVNAGAGKDR
DGKPLFKLSVNDFVIKALALALQRVPNANAVWAEDRILKFRHSDVGVAVAVDGGLFTPVI
RRAEQKTLSTLSAEMKDLAGRARSRKLKPEEYQGGATAVSNLGMYGIKEFGAVINPPHGT
ILAVGAGEARVVARNGAPAVVQAMTVTLSCDHRVVDGALGAELLAAFKSLIENPMGMLV
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaacgtgctgatgcccgccctctcgcccaccatggagaagggcaacctcgcc
aagtggctgaagaaggagggcgacccggtcaagtccggcgacgtgctggccgagatcgag
accgacaaggcgaccatggaggtcgaggcggtcgacgagggcgtgctcgccaggatcgtg
gtgcccgagggcaccgcggacgtgccggtgaacgatctcatcgccgtgatcgcggcggag
ggcgaggacccggcgcgcgtcggggccggggagggggcggcgcaaggggcggcgaagggg
gcggcgcccccgccgcgggatgaggaccgcacggagggcggggcgagcctcgcctacgcg
cgcgtgaacgaggcgccggacgccgccaaggccgcggcgaacggggccgcggcgaagccg
aacggcgcggcgcccggcggcgccccgcagggcgccgcgccggcgggggggcggatcctc
gcctcgccgctcgcgcgccgcatcgccaagcaggaggggatcgacctctcgcgcgtccgc
ggctccggcccgcacggcagggtgatcgagcgcgacgtgcgcgcggccctcaaggagggc
ccggcgccggccgccccggcgggcgccccggcggccgcgcccggcggggcgaccccgccc
gccgccaaacccgcggccggcgccccggcggcctccggcctgaccggcgaccaggtcaag
gcgatgttcgagagggggagctacgaggaggtccccctcgacgggatgcgcaggaccatc
gccaagcgcctcgtcgagtcgaagcagaccgtcccgcacttctacctctcgctcgattgc
gaactcgacgcgctgctggcgctgcgcgagcaggtcaatgcgggcgccggcaaggaccgg
gacggcaagccgctgttcaagctctcggtgaacgacttcgtcatcaaggcgctggcgctg
gccctgcagcgggtgccgaacgccaacgcggtctgggccgaggaccggatcctgaagttc
cgccactccgacgtcggcgtcgcggtggcggtggacgggggcctgttcacgccggtgatc
cgcagggccgagcagaagacactctcgaccctctcggccgagatgaaggacctcgccggc
cgcgcccgcagccgcaagctgaagcccgaggagtaccagggcggcgcgacggcggtgtcg
aatctcggcatgtacggcatcaaggaattcggcgcggtcatcaacccgccccacggcacg
atcctggcggtgggggcgggcgaagcccgggtcgtggccaggaacggcgcgccggcggtg
gtgcaggccatgaccgtgacgctctcctgcgaccaccgggtggtggacggggcgctcggc
gccgaattgctcgccgccttcaagagcctgatcgagaacccgatggggatgctggtgtga

DBGET integrated database retrieval system