KEGG   Methylobacterium sp. 4-46: M446_5992Help
Entry
M446_5992         CDS       T00679                                 

Definition
(GenBank) DNA polymerase III, alpha subunit
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Organism
met  Methylobacterium sp. 4-46
Pathway
met03030  DNA replication
met03430  Mismatch repair
met03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:met00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    M446_5992
   03430 Mismatch repair
    M446_5992
   03440 Homologous recombination
    M446_5992
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:met03032]
    M446_5992
   03400 DNA repair and recombination proteins [BR:met03400]
    M446_5992
Enzymes [BR:met01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     M446_5992
DNA replication proteins [BR:met03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     M446_5992
DNA repair and recombination proteins [BR:met03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     M446_5992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_alpha DNA_pol3_finger PHP HHH_6 tRNA_anti-codon DUF4539 Malate_synthase DUF1707
Motif
Other DBs
NCBI-ProteinID: ACA20269
UniProt: B0UJ30
LinkDB All DBs
Position
complement(6578923..6582429)
Genome map
AA seq 1168 aa AA seqDB search
MRVLKDVGFVHLHTHSSYSLLEGALKLGDLVKAAAGDRQPALALTDTNNLFGALEFSEKA
AGLGIQPIAGIQLSVLFEAPEPGQRGGPAPLPHLVLLAKDETGYGHLLKLASLAYFDGPL
GEAPRVPVEALRDCAPGLIALTGGPGGPLDSCLRAARPEHAAGRLARLVEAFGEDHLYVE
IQRHGLPDERAVEAELIGLADRHGLPLVATNEPFFARPEDYEAHDALLAIAEGRLVSDEK
RRRLTPRHDFKTRAAMAELFRDLPDALAASVEIAMRCAYRVRTRKPILPSFGVSGGPAAR
DAAQAGSPAPAGDPALDEAGELKRQAEAGLARRLAEAGPAEGLSEQDYRDRLAYEIGIIT
KMKFPGYFLIVSDFIKWAKANDIPVGPGRGSGAGSLVAWSLLITDLDPLRFGLLFERFLN
PERVSMPDFDIDFCVVGRERVIEYVQSRYGEAQVAQIITFGTLLARGVLRDVGRVLEMPY
GQVDKLTKLVPQNPANPVTLVQAIEGEPRLQSAMEEEPVVARLMEIAKKLEGLHRHASTH
AAGVVIGDRPLEALVPLYRDPKTGMRVTQFNMKWVEQAGLVKFDFLGLKTLTVLRGATDL
LEQRGITLDLAALPLDDERTYERLRKGEVVGVFQVESAGMRKALVEMCADRFEDLIALVA
LYRPGPMANIPVYCERKLGRDAGNEAVWYPHPKLEPILAETFGIIVYQEQVMEVAKVLAG
YSLGDADLLRRAMGKKIKAEMDAQRDRFLKGAMERGLDKAKANEIFDLLAKFADYGFNKS
HAAAYALITYQTAYLKANYPVEFLAASMSQDLDDTDKLAELRQDAQRLAIKVEPPSVNRS
GVTFEVHDGTIRYALAAIKGVGRAAVEAIVQARGDRPFRDLGDFARRLNPRLVNKRTLES
LVGAGALDEIEPDRARAFAAIEPMLRLAQGALEAETVGMTDMFGGVAAATVALRIPPYDP
WPAADRLKKEYEAVGFFLSGHPLDEYGELLKKLRVQTWVEFCRSVRAGNSVGRVAATVLD
RSERRTKTGNKLGIVNLSDQTGHFEAIVFSEGLQQYRELLEPGRALALQLQASAEGEDVR
ARIQTCEPLDQAVARYQKGMRIYLRDERPIPSVQQRLTTRGEGEVSLILILDGGEREVEV
KLRDRYQASPQIAGALRAVPGVVQVEVN
NT seq 3507 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggttctcaaggacgtcggcttcgttcacctccacacccattcctcctactcgctg
ctggagggggcgctgaagctcggcgacctcgtcaaggcggcggccggcgaccgccagccg
gcgctggcgctcaccgacaccaacaacctgttcggggcgctggaattctccgagaaggcg
gccggcctcggcatccagccgatcgccgggatccagctctcggtgctgttcgaggcgccc
gagcccggccagcgcggcgggcccgcgcccctgccccacctcgtgctgctcgccaaggac
gagaccggctacggccacctcctgaagctcgcgagcctcgcctatttcgacggtcccctc
ggcgaggcgccccgggtcccggtcgaggccctgcgggattgcgcgccggggctgatcgcg
ctcaccggcgggcccggcggcccgctcgattcctgcctgcgggcggcgcggccggagcac
gcggcgggccgcctcgcgcggctcgtcgaggccttcggggaggatcacctctacgtcgag
atccagcgccacggcctgcccgacgagcgggcggtcgaggccgagctgatcggcctcgcc
gaccgccacggcctgcccctggtcgccaccaacgagccgttcttcgcgcgtcccgaggat
tacgaggcgcacgacgcgctcctcgccatcgcggagggccgcctcgtctcggacgagaag
cgccgccggctcacgccgcgccacgatttcaagacccgcgcggccatggccgagctcttc
cgcgacctgccggacgcgctcgcggcgagcgtcgagatcgcgatgcgctgcgcctaccgg
gtgcgcacccgcaagccgatcctgccgagcttcggggtgagcggcgggccggcggcgagg
gatgccgcgcaggcgggctcccccgccccggcgggcgatcccgccctcgacgaggcgggg
gagctgaagcggcaggcggaggccgggctggcgcgccgcctcgccgaggccggccccgcc
gaggggctgagcgagcaggattaccgggaccggctcgcctacgagatcggcatcatcacc
aagatgaagttcccgggctacttcctgatcgtctcggacttcatcaagtgggccaaggcc
aacgacatccccgtcgggcccggccgcggctcgggcgcgggctcgctggtggcgtggtcg
ctcctcatcaccgacctcgacccgctccgcttcggcctgctgttcgagcgcttcctcaac
cccgagcgcgtctcgatgccggatttcgacatcgacttctgcgtcgtcgggcgcgagcgg
gtgatcgagtacgtgcagagccgctacggcgaggcccaggtcgcgcagatcatcaccttc
ggcacgctgctcgcccgcggcgtgctgcgcgacgtcggccgcgtgctggagatgccctac
gggcaggtcgacaagctcaccaagctggtgccgcagaacccggcgaacccggtgaccctc
gtccaggccatcgagggcgagccgcggctgcagagcgccatggaggaggagccggtcgtc
gcccggctcatggagatcgccaagaagctggagggcctgcaccgccacgcctcgacccac
gcggccggcgtggtgatcggcgaccggccgctcgaggcgctggtgccgctctaccgcgac
ccgaagaccggcatgcgggtcacccagttcaacatgaagtgggtggagcaggccggcctc
gtgaagttcgacttcctcggcctcaagaccctgacggtgctgcgcggcgccaccgacctg
ctcgagcagcgcggcatcaccctcgacctcgcggccctgcccctcgacgacgagcgcacc
tacgagcgcctgcgcaagggcgaggtggtcggcgtgttccaggtggaatcggcgggcatg
cgcaaggcgctcgtcgagatgtgcgccgaccgcttcgaggacctgatcgcgctcgtcgcc
ctctaccggccgggcccgatggccaacatcccggtctattgcgagcgcaagctcgggcgc
gacgccggcaacgaggcggtctggtacccccatcccaagctggagccgatcctggccgag
accttcggcatcatcgtctaccaggagcaggtgatggaggtcgccaaggtgctcgccggc
tactcgctcggcgacgccgacctcctgcgccgcgccatgggcaagaagatcaaggccgag
atggacgcccagcgcgaccgcttcctcaagggggcgatggagcgcggcctcgacaaggcc
aaggccaacgagatcttcgacctgctggccaagttcgcggattacggcttcaacaagtcg
cacgcggccgcctacgcgctgatcacctaccagaccgcctacctgaaggcgaactacccg
gtcgagttcctggccgcctcgatgtcccaggacctcgacgacaccgacaagctcgccgag
ttgcgccaggacgcgcagcgcctggcgatcaaggtcgagcccccgtcggtgaaccgctcc
ggcgtcaccttcgaggtgcatgacgggacgatccgctacgcgctcgcggcgatcaagggc
gtggggcgggccgcggtcgaggcgatcgtgcaggcgcggggcgaccggcccttccgcgac
ctcggcgacttcgcccgccgcctcaacccgcggctggtcaacaagcgcacgctggagagc
ctcgtcggcgcgggcgccctcgacgagatcgagcccgaccgggcgcgggccttcgcggcg
atcgagccgatgctgcgcctggcgcagggcgcgctcgaggccgagacggtcgggatgacc
gacatgttcgggggcgtcgccgccgccacggtggcgctgcgcatcccgccctacgatccc
tggccggccgccgaccggctcaagaaggagtacgaggcggtcggcttcttcctgtcgggc
cacccgctcgacgagtacggggagctcctcaagaagctgcgcgtccagacctgggtcgag
ttctgccgctcggtgcgggccggcaacagcgtcggccgggtcgccgccacggtgctcgac
cgctcggagcggcgcaccaagaccggcaacaagctcggcatcgtcaacctctcggaccag
accgggcatttcgaggcgatcgtgttctcggaggggctgcagcaataccgcgaattgctg
gaacccgggcgggcgctcgccctccagctccaggcgagtgccgagggcgaggacgtgcgc
gcccgcatccagacctgcgagcccctcgaccaggcggtggcccgctaccagaagggcatg
cggatctacctgcgcgacgagcgcccgatcccgagcgtgcagcagcggctcaccacccgc
ggcgagggcgaggtctcgctgatcctgatcctcgacgggggcgagcgcgaggtcgaggtg
aagctgagggaccgctaccaggcgagcccgcagatcgccggcgcgctccgggcggtgccg
ggggtggtgcaggtcgaggtgaattga

DBGET integrated database retrieval system