KEGG   Methylobacterium sp. 4-46: M446_6942Help
Entry
M446_6942         CDS       T00679                                 

Definition
(GenBank) chromosome segregation protein SMC
  KO
K03529  chromosome segregation protein
Organism
met  Methylobacterium sp. 4-46
Brite
KEGG Orthology (KO) [BR:met00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:met03036]
    M446_6942
Chromosome and associated proteins [BR:met03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    M446_6942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N AAA_21 AAA_23 AAA_15 AAA_29 ABC_tran DUF4201
Motif
Other DBs
NCBI-ProteinID: ACA21176
UniProt: B0ULX9
LinkDB All DBs
Position
7639150..7642584
Genome map
AA seq 1144 aa AA seqDB search
MRLTRLRIVGFKTFVEPSEVPIEPGLTGIIGPNGCGKSNLVEALRWVMGESSHKSLRASG
MDDVIFSGSGGRPGRSHAEVTLSLDNSARTAPAAFNGADALDVTRRIDRGAGSTYRVNGR
EVRARDVQLLFADASTGARSPAMVRQGQVAEMIAAKPQARRRVLEEAAGIGGLHARRHEA
ELRLRAAEENLARVEDVLGAISSGVDSLRRQARAAARYREVAAAIRRGEALLHLIAHGRA
REEAARAGREAAAAAERVAAAQAGQAAAATAQALAAAGLPRLREEEARAAAALQRLTQAA
AALEAEENRAAERLRDLTQRLADLARDAARQAESRDDARASLARLDAEAAALAADPDGAG
ARAAAEQRAVAAEAALAAAEAALSAAQAAAAEGSARRGALERALRDGRTRAERLAAERAR
LARERAGEADEAPALARLRAALAEASALSEQAEDEAAAAREDLAEARDAEARGRPALADA
EREAARREAEAGTLAGLVAPPARFPPLLDALRVAPGHEAALAAALGEDLDAATDPAAPAH
WAGAPEDPADPPLPAGALPLSRVVDGPPLLARRLRQVGIVARGEAAALAARLRPGQRLVT
LAGDLVRWDGFTVSAEAPSPAALRLAARARLDALRQAAAKAREAAQAARAAGAVRQERAR
EAAARETRALDAARLARTRLDAARAALVAAERRAAEAAARRAARDEAEARLAEEAEEAAA
RIEAAEDALAALPGQAPEDLARLRQAVATRRAAAAEARAAALALARAAAERRRRAAALAE
ERARWGDRALRAAAALDDLAGRRAAAEEERAALAGAPGAFAAERRRLAGAGREAEAARRT
AADRLAAAEAGLAEADRRARAALEALGAAREARAAAAAAQEALARRLAEVARAIPETLGA
TLEALPALAGLAPGEALPEAEAVEARLSGLRADRERIGAVNLRAEAELAEAEERRDALSR
ERDDLLEAIRRLRGAIASLNREGRERLLAAFAAVNGHFERLFTTLFGGGTAELTLVDAED
PLEAGLEILARPPGKKPQTMTLLSGGEQALTAIALIFAVFLTNPSPVCVLDEVDAPLDDA
NVERYCDLLGRMARDTDTRFLVITHNPITMARMDRLCGVTMAERGVSQLVSVDLAGARAL
AEAM
NT seq 3435 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctcacccgcctgcgcatcgtcggcttcaagaccttcgtcgagccgagcgaggtc
ccgatcgagcccggcctcaccgggatcatcgggccgaacggctgcggcaagtcgaacctg
gtcgaggccctgcgctgggtgatgggcgagagctcgcacaagagcctgcgcgcctccggc
atggacgacgtgatcttctccggatccggtggccgacccggccgcagccacgcggaggtg
acgctgagcctggacaacagcgcccgcacggcccccgccgccttcaacggcgcggacgcg
ctcgacgtgacgcggcggatcgaccggggcgccggctccacctaccgcgtcaacggccgc
gaggtgcgcgcccgcgacgtgcagctgctcttcgccgacgcctcgacgggtgcgcgctcg
cccgcgatggtccgccagggccaggtggccgagatgatcgcggccaagccccaggcgcgg
cggcgggtgctggaggaggcggccgggatcggcggcctgcatgcccgccgccacgaggcg
gagctgcgcctgcgcgccgccgaggagaacctcgcccgggtcgaggacgtgctcggcgcg
atcagctccggggtcgattccctgcggcggcaggccagggccgccgcgcgctaccgcgag
gtcgccgccgcgatccgccggggcgaggcgctgctccacctcatcgcccacgggcgggcg
cgggaggaggcggcgcgggccgggcgggaggccgccgccgccgccgagcgggtcgccgcc
gcgcaggcggggcaggccgccgccgcgaccgcccaggccctcgccgccgccggcctgccc
cgcctgcgcgaggaggaggcgcgggccgccgccgcgctgcagcggctgacccaggcggcg
gcggccctcgaggccgaggagaaccgcgccgccgagcgcctgcgcgacctcacccagcgc
ctcgccgacctcgcccgcgacgccgcccggcaggcggagagccgcgacgacgcgcgggcg
agcctcgcccgcctcgacgccgaggccgccgccctggcggccgacccggacggtgcgggc
gcgcgcgcggcggccgagcagcgggccgtcgccgccgaggccgccctcgccgccgccgag
gcggcgctctcggccgcccaggccgccgccgccgaggggagcgcccgccgcggcgccctg
gagcgcgccctgcgcgacgggcgcacccgcgccgagcgcctcgccgccgagcgggcgcgc
ctcgcccgcgagcgggccggcgaggccgacgaggcgccggcgctcgcgcgcctgcgcgcc
gccctggcggaggcgtcggcgctgagcgagcaggccgaggacgaggccgccgcggcgcgc
gaggacctcgcggaggcccgcgacgcggaggcgcgcgggcgtccggccctggccgacgcg
gagcgcgaggccgcccgccgcgaggccgaggcgggcaccctcgcgggcctggtggcgcct
cccgcgcgcttcccgccgctcctcgacgcgctgcgcgtcgcgccggggcacgaggcggcc
ctcgcggcggccctgggcgaggatctcgacgcggcgaccgacccggccgcccccgcccac
tgggccggggcgccggaggatcccgccgacccaccgcttcccgccggtgccctgcccctc
tcgcgcgtggtggacggcccgccgctcctcgcccggcgcctgcggcaggtcgggatcgtc
gcccgcggcgaggccgccgccctggcggcgcgcctgcggccgggccagcgcctcgtcacc
ctcgcgggcgacctcgtgcgctgggacggcttcacggtctccgccgaggcgccctcgccc
gccgccctgcgcctcgccgcgcgcgcccggctcgacgcgctgcggcaggcagcggccaag
gcccgcgaggcggcgcaggccgcccgcgccgccggcgcggtgcggcaggagcgggcgcgc
gaggccgccgcccgggagacgcgggccctcgacgcggcccgcctcgcccgcacccgcctc
gacgcggcccgcgccgccctggtggccgcggagcgccgcgcggccgaggcggcggcgcgg
cgcgcggcccgggacgaggccgaggcgcggcttgccgaggaggccgaggaggcggcggcc
cggatcgaggccgccgaggacgccctcgcggccctgccggggcaggcgccggaggatctc
gcccgcctgcggcaggcggtggcgacccggcgcgccgccgcggccgaggcgagggccgcc
gccctcgccctcgcccgtgcggccgcggagcgccgccgccgcgccgccgccctggccgag
gagcgggcgcgctggggcgaccgcgccctgcgcgccgcggccgccctcgacgacctcgcc
gggcgccgcgccgcggccgaggaggagcgggccgccctcgccggggcacccggcgccttc
gcggccgagcggcggcggctcgcgggcgccggccgggaggccgaggcggcgcggcgcacg
gcggcggatcggctcgcggccgccgaggccgggctcgccgaggccgaccggcgcgcccgg
gccgccctcgaggccctcggcgcggcgcgggaggcccgggccgccgcggcggcggcgcag
gaggcgctggcgcgccgcctcgccgaggtcgcccgggcgatccccgagacgctcggcgcg
accctggaggcgctccccgccctcgccggcctcgccccgggcgaggccctgccggaggcg
gaagcggtcgaggcccggctctccggcctgcgggccgaccgggagcggatcggggccgtg
aacctgcgggccgaggcggaactggccgaggccgaggagcggcgggacgcgctctcgcgc
gagcgcgacgacctcctggaggcgatccggcgcctgcgcggggccatcgcgagcctcaac
cgcgaggggcgcgagcggctgctcgccgccttcgcggccgtgaacgggcatttcgagcgc
ctgttcaccacgctgttcggcgggggcaccgccgaactgacgctcgtcgatgccgaggat
ccgctggaggccggcctcgagatcctggcccgcccgccgggcaagaagccccagaccatg
accctgctctcgggcggcgagcaggcgctcaccgccatcgcgctgatcttcgcggtgttc
ctgaccaacccgtcaccggtctgcgtgctcgacgaggtcgacgcccccctcgacgacgcc
aacgtcgagcgctactgcgacctcctcggccgcatggcccgggacaccgacacccgcttc
ctggtaatcacccacaaccccatcaccatggcgcggatggaccggctgtgcggggtcacc
atggcggagcggggcgtgtcgcaactcgtctcggtcgacctcgcgggggcgcgggcgctc
gccgaggcgatgtga

DBGET integrated database retrieval system