KEGG   Methylobacterium sp. AMS5: Y590_07725Help
Entry
Y590_07725        CDS       T04283                                 

Definition
(GenBank) shikimate kinase
  KO
K13829  shikimate kinase / 3-dehydroquinate synthase [EC:2.7.1.71 4.2.3.4]
Organism
meta  Methylobacterium sp. AMS5
Pathway
meta00400  Phenylalanine, tyrosine and tryptophan biosynthesis
meta01100  Metabolic pathways
meta01110  Biosynthesis of secondary metabolites
meta01130  Biosynthesis of antibiotics
meta01230  Biosynthesis of amino acids
Module
meta_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:meta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Y590_07725
Enzymes [BR:meta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     Y590_07725
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     Y590_07725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase SKI Fe-ADH_2 Fe-ADH AAA_33 AAA_18 Cytidylate_kin2 AlaDh_PNT_C AAA_22
Motif
Other DBs
NCBI-ProteinID: AMB44778
UniProt: A0A0X1SFK2
LinkDB All DBs
Position
complement(1627733..1629472)
Genome map
AA seq 579 aa AA seqDB search
MTVPLPPAPPPGEPIEARLRRGLGARSIVLVGLMGAGKSTVGRRLAGRLGLMFKDADHEI
EAAAKLTIADIFTIYGEASFREGEERVIARLLREGPMVLATGGGAFMREATRARIAEGAI
SVWLKADLDVLMRRVRKRNTRPLLQTEDPEATMRALMEVRHPVYAQADVTVLSREVSHDR
VVEDVMEALDMHINPSHTTQSQHLIFSMPQQPSRVNVPLSGGREYDIRIGRGLIDAVGAE
ARDLGARAAGIVTDETVAGLYGERVRASLEAAGLRCGIIAVPPGEASKSYAEFARVCDGL
LAQKIERGDLVVALGGGVVGDLAGFAAASLRRGVRFLQVPTTLLAQVDSSVGGKTGINSP
LGKNLIGAFHQPRLVLADTAALDTLSEREMRAGYAEVAKYGLIGDAGFFEWCEANWAGIF
SGGPERDEAVAACCRAKAGVVTRDEREDGERALLNLGHTFGHALERLTGYDAARLVHGEG
VAIGLALAFRFSARLGLCPGQDAGRVANHLALAGLPTRLQQVPGGAGDPDALLDAMAQDK
KVRDGQLTFILAHGIGQSFIAPGIDAGEVRAFLEEELRG
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtccccctgccgccggcgccgccgccaggcgaaccgatcgaagcacgcctgcgc
cgcggccttggagcccggtcgatcgtgctcgtcggtctgatgggggcgggcaagagcacc
gtcgggcgccgcctcgccggccgcctcgggctgatgttcaaggacgccgaccacgagatc
gaggcggcggccaagctcaccatcgccgacattttcacgatctacggcgaggcgagcttt
cgcgagggcgaggagcgggtcatcgcgcgtctgctgcgcgaggggccgatggtgctggcc
accggcggcggcgccttcatgcgcgaagcgacgcgggcgcggatcgccgagggggccatc
tcggtctggctcaaggccgacctcgacgtgctgatgcgtcgcgtgcgcaaacgcaacacg
cgccccctgctccagaccgaggatccggaggcgaccatgcgcgcactgatggaggtgcgc
catcccgtctatgcccaagccgatgtcacggtgctgtcccgcgaagtgtcccacgaccgc
gtggtggaggacgtgatggaagctctcgatatgcacatcaacccgtctcatacgacacaa
tcgcaacatttgatattctctatgcctcagcaaccctcgcgtgtgaacgttcccctgtcg
ggtgggcgcgaatacgacattcgaatcggccggggcctcatcgacgcggtgggcgcggag
gcgcgggatctcggcgcccgggccgccggcatcgtcaccgacgagacggtcgccggcctc
tacggcgagcgcgtgcgggcaagcctcgaggccgccggcttgcgctgcggaatcatcgcc
gtgccgccgggcgaggcttcgaagagctacgcggaattcgcccgcgtctgcgacgggctc
ctggcccagaagatcgagcgcggcgacctcgtcgtggcgctcggcggcggggtggtcggc
gatctcgcgggtttcgcggcggcctccctgcggcgcggtgtccgcttcctccaggttccg
acgaccttgcttgcccaggttgattcctcggtcggcggaaagaccgggatcaactcgccg
ctcggcaagaatctgatcggcgccttccaccagccccgcctcgtgctggccgacaccgcc
gccctcgacacgctctccgagcgcgagatgcgggcgggttacgccgaggtcgccaagtac
ggcctgatcggggatgcgggcttcttcgagtggtgcgaggcgaactgggccggcatcttc
tccggcgggccggagcgcgacgaggcggtggccgcctgctgccgcgccaaggccggcgtc
gtcacccgcgacgagcgagaggacggcgagcgggcgctgctcaatctcggccacaccttc
ggccacgccctggaacggctgaccggctacgacgcggcccgcctcgtccacggcgagggc
gtcgcgatcggtctggcgctcgccttccgcttctcggcccggctcggcctctgccccggc
caggatgcggggcgcgtggccaaccacctcgcgctcgccggactgccgacccgcctgcaa
caggtgccgggcggggccggcgacccggatgccctcctcgacgccatggcccaggacaag
aaggtccgcgacgggcagctcaccttcatcctcgcccacggcatcggccagagcttcatt
gcgccgggaatcgacgcgggcgaagtgcgggccttcctggaggaggagctgcggggctga

DBGET integrated database retrieval system