KEGG   Methylobacterium sp. AMS5: Y590_07750Help
Entry
Y590_07750        CDS       T04283                                 

Gene name
sucA
Definition
(GenBank) MFS transporter
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
meta  Methylobacterium sp. AMS5
Pathway
meta00020  Citrate cycle (TCA cycle)
meta00310  Lysine degradation
meta00380  Tryptophan metabolism
meta01100  Metabolic pathways
meta01110  Biosynthesis of secondary metabolites
meta01120  Microbial metabolism in diverse environments
meta01130  Biosynthesis of antibiotics
meta01200  Carbon metabolism
Module
meta_M00009  Citrate cycle (TCA cycle, Krebs cycle)
meta_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:meta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Y590_07750 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    Y590_07750 (sucA)
   00380 Tryptophan metabolism
    Y590_07750 (sucA)
Enzymes [BR:meta01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Y590_07750 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N SHOCT
Motif
Other DBs
NCBI-ProteinID: AMB44783
UniProt: A0A0X1SFW4
LinkDB All DBs
Position
1634202..1637192
Genome map
AA seq 996 aa AA seqDB search
MARQDANEALLQTSFLYGANAAWIEELQAAYARDPNSVDPEWQRFFKDLGEDDALVKKNA
EGASWAKPNWPVVANGEIVSALDGNWGALEKTLGDKIQAKAQPGKPGDSTKGAAIVAATG
VSVEQATKDSVRAIMLIRAYRMRGHLHAKLDPIGLAPRGDHEELHPQHYGFQESDWDRKI
FLDNVLGMEFSTIREIVAILERTYCQTLGVEFMHISDPEEKAWIQERIEGKDKEISFTPE
GRRAILNKLIEAEGFEKFLDLKYTGTKRFGLDGGESMVPAMEQIIKRGGALGVEEIVLGM
AHRGRLNVLTNVMAKPFRAVFHEFKGGSASPAEVEGSGDVKYHLGASSDRAFDDNTVHLS
LTANPSHLEIVDPVVLGKVRAKQDQKAKPNVERRRVLPLLIHGDAAFAGQGVVAECLGLS
GLKGHRTGGSIHFIINNQIGFTTDPRFSRSSPYPSDVAKMVEAPIFHCNGDDPEAVTFAA
KVAVEYRQKFGKPVVIDMLCYRRFGHNEGDEPAFTQPKMYQRIRKHPTALETYGKKLVAQ
GDLTQEQLDARKAEFRAMLESELEVAGGYKPNKADWLDGRWSGFKAVREDVDDPRRGRTG
VPLETLRDIATRITTPPPGFHLHRTIQRFFDNRAKAVETGVGIDWATAEALAFGSLLIEG
HRVRLSGQDVERGTFSQRHAVVIDQENEQRYTPLNSLREGQASLEVINSMLSEEAVLGFE
YGYSLAEPNSLVLWEAQFGDFANGAQVVIDQFISSGERKWLRMSGLVMLLPHGYEGQGPE
HSSARLERYLQMCAEDNMQVANCSTPSNYFHILRRQLKRDFRKPLILMTPKSLLRHKRAV
SKIEDIAEGSTFHRILWDDAEHDENGVKLVRDDKIRRVVLCSGKVYYDLYDEREKRGVND
VYLMRVEQLYPFPLKALANEMTRFRNAEVVWCQEEPKNMGSWSFVEPYLDWVLGQAGSAS
KRPRYVGRPASASTAVGLMSKHLAQLQAFLNEALAV
NT seq 2991 nt NT seq  +upstreamnt  +downstreamnt
atggcacgccaggacgcgaacgaagcccttctccaaacctcctttctctacggcgccaac
gccgcctggatcgaggaactgcaggcggcctatgcccgcgacccgaactcggtcgatccc
gagtggcagcggttcttcaaggatctgggcgaggacgacgccctggtgaagaagaacgcc
gagggcgcctcctgggccaagccgaactggccggtggtggccaacggcgagatcgtctcg
gcgctcgacggcaattggggcgccctggaaaagacgctcggcgacaagattcaggccaag
gcccagcccggcaagcctggcgactcgaccaagggcgcggccatcgtcgcggccacgggc
gtctcggtggagcaggccaccaaggattccgtacgcgcgatcatgctgatccgcgcctat
cgcatgcgcggccacctccacgccaagctcgacccgatcgggctcgccccgcgcggcgat
cacgaggaactgcatccgcagcattacggcttccaggagagcgactgggaccgcaagatc
ttcctcgacaacgtgctcggcatggaattctcgacgatccgcgagatcgtcgcgatcctg
gagcgcacctactgccagacgcttggcgtcgagttcatgcacatctccgaccctgaggag
aaggcgtggatccaggagcgcatcgagggcaaggacaaggaaatctcgttcacgccggaa
gggcgccgggcgatcctgaacaagctgatcgaggccgagggcttcgagaagttcctcgat
ctcaaatacaccggcaccaagcgcttcggcctcgacggcggcgagtcgatggtcccggcc
atggagcagatcatcaagcgcggcggcgcgctcggcgtcgaggaaatcgtactcggcatg
gcccatcgcggccggctgaacgtgctcaccaacgtgatggccaagcccttccgggcggtg
ttccacgagttcaagggcggatcggcctcccccgccgaggtcgagggctcgggcgacgtg
aagtaccatctcggcgcctcgtccgaccgcgccttcgacgacaacaccgtccacctctcg
ctcaccgccaacccgtcccacctcgagatcgtcgatccggtggtgctggggaaggtgcgc
gccaagcaggaccagaaggccaagccgaacgtcgagcgccgccgcgtgctgccgctcctc
atccatggcgacgcggcctttgccggccagggcgtggtcgcggaatgcctcggcctgtcc
ggcctgaagggtcaccgcaccggcggctcgatccacttcatcatcaacaaccagatcggc
ttcaccaccgatccgcgcttctcgcgctcctcgccctatccgtccgacgtggcgaagatg
gtggaggcgccgatcttccactgcaacggcgacgacccggaggcggtgaccttcgccgcg
aaggtcgcggtcgagtaccggcagaaattcggcaagccggtcgtgatcgacatgctgtgc
taccgccgcttcggccacaacgagggcgacgagccggccttcacccagccgaagatgtac
cagcggatccgcaagcatccgaccgcgctggagacctacggcaagaagctcgtcgcacag
ggtgatctgacccaggagcagctcgacgcgcgcaaggccgagttccgcgcgatgctggaa
agcgagctcgaggtcgcgggcggctacaagcccaacaaggccgattggctcgatggccgc
tggtccggcttcaaggccgtgcgcgaggacgtggacgatccccgccgcggccgcaccggg
gttccgctcgagacgctgcgcgacatcgccacccggatcaccacgcccccgccgggcttc
cacctgcaccgcacgatccagcgcttcttcgacaaccgcgccaaggccgtcgagaccggc
gtcggtatcgattgggccaccgccgaggcgctcgccttcggctcgctgctgatcgagggc
caccgggtccggctctcgggccaggacgtcgagcgcggcaccttctcccagcgccacgcc
gtggtgatcgatcaggagaacgagcagcgctacacgccgctcaactccctgcgcgaggga
caggcgagcctggaggtcatcaactcgatgctctccgaggaggcggtgctcggcttcgag
tacggctactcgctggccgagccgaactccctggtgctgtgggaggcgcagttcggcgac
ttcgccaacggcgcgcaggtcgtcatcgaccagttcatctcatcgggcgagcgcaagtgg
ctgcgcatgtccggcctcgtgatgctccttccccacggctacgagggccagggaccggag
cactcgtccgcccgtctggagcgctatctccagatgtgcgccgaggacaacatgcaggtt
gccaactgctcgacgccctcgaactacttccacatcctgcgccgtcagttgaagcgcgac
ttccgcaagccgctgatcctgatgacgccgaaatcgctgctgcgccacaagcgggcggtc
tcgaagatcgaggacatcgcggagggctcgaccttccaccgcatcctgtgggacgacgcc
gagcacgacgagaacggcgtgaagctcgtgcgcgacgacaagatccgccgcgtcgtgctg
tgctcgggcaaggtctattacgacctctacgacgagcgggagaagcgcggcgtcaacgac
gtctacctgatgcgcgtcgagcagctctaccccttcccgctcaaggctctggccaacgag
atgacccgcttccgcaacgcggaggtggtgtggtgccaggaagagcccaagaacatgggt
tcgtggtccttcgtcgagccctatctcgattgggtgctgggccaggccggctccgcctcg
aagcggccccgctacgtcggccgcccggcctcggcctcgaccgcggtcggcctgatgtcg
aagcacctcgcccagctccaggccttcctcaacgaggcgctggcggtctga

DBGET integrated database retrieval system