KEGG   Methylobacterium sp. AMS5: Y590_15800Help
Entry
Y590_15800        CDS       T04283                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
meta  Methylobacterium sp. AMS5
Pathway
meta03030  DNA replication
meta03410  Base excision repair
meta03420  Nucleotide excision repair
meta03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:meta00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Y590_15800
   03410 Base excision repair
    Y590_15800
   03420 Nucleotide excision repair
    Y590_15800
   03430 Mismatch repair
    Y590_15800
Enzymes [BR:meta01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Y590_15800
    6.5.1.6  DNA ligase (ATP or NAD+)
     Y590_15800
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Y590_15800
DNA replication proteins [BR:meta03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Y590_15800
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Y590_15800
DNA repair and recombination proteins [BR:meta03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Y590_15800
   NER (nucleotide excision repair)
    Other NER factors
     Y590_15800
   MMR (mismatch exicision repair)
    Other MMR factors
     Y590_15800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AMB46389
UniProt: A0A0X1SKA0
LinkDB All DBs
Position
3391803..3393707
Genome map
AA seq 634 aa AA seqDB search
MNDFAHLLDRLAYEPRRNAKLRLLQDFFAGTPDPERGWALAAMTGGLTFREAKPALIRGL
VEERVDPVLFSLSHNYVGDLAETTALIWPGPGESPDASPSPRMRGEGRDDRVVGATSGSE
GEEALTDEALPESPPHHRRPARSADDAVAEALCPQAGRGDAPGIGHNNPPLCVPPLAEVV
ETLATTPKRELPQHLARWLDALDETGRWALLKLVTGNLRVGVSARLAKTAVGALGGHEAD
AVEEVWHGLRPPYPELFAWVEGRAERPESRNPAPFRPPMLSHPVEEFEDLDKLEPEAFSA
EWKWDGIRVQLAGGRDSQGRQVQKVYSRTGEDISAAFPDLAEAITFDGALDGELLILREG
RVQSFNVLQQRLNRKAVTGKLLEEFPAHVRAYDVLSAEGEDLRPLPFAERRPRLEALVQR
LDHARIDLSPVVSFATWDDVAAARADPASAGAGADADAIEGVMLKRRNSPYLPGRPKGPW
WKWKREPYVVDAVMMYAQRGHGKRSSFYSDYTFGCWREGAEGEELVPVGKAYHGFTDAEL
QKLDRYVRNHTTKRFGPVREVAYGREAGLVLEIAFEGVQRSTRHKSGVAMRFPRVSRIRW
DKPAAEADRVDVLERILARGEREVAPGAALEASE
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgacttcgcccacctcctcgaccgactcgcctacgagccgcgccgcaacgccaag
ctgcgcctgctccaggatttcttcgccggcacccccgacccggagcgcggctgggcgctc
gccgccatgaccggcggactcaccttccgcgaggccaagccggcgctgatccgcgggctg
gtggaagagcgggtcgatccggtgctgttctcgctctcgcacaactacgtgggcgacctc
gccgagaccacggcgctgatctggccgggcccgggtgaatcgccggatgcttccccctct
ccccgcatgcggggagagggtcgcgacgaccgcgtcgtcggcgcgacaagcggcagcgag
ggtgaggaggccttgacggacgaggctcttccggaatcgccccctcaccatcgccggccg
gctcgctctgccgacgacgcggtcgccgaagccctctgcccgcaagcggggagaggggac
gcccctggcatcggccacaataaccctcctctctgcgtcccccccctcgccgaggtcgtc
gaaaccctcgccaccaccccgaagcgcgaactcccgcagcatctcgcccgttggcttgac
gccctcgacgagaccgggcgctgggcgcttctcaagctcgtcaccggcaaccttcgcgtc
ggcgtttcggcccgtctggccaagacggcggtcggcgcgctcggcggccacgaggcggat
gcggtcgaggaagtctggcacgggctcaggccgccctatcccgagctgttcgcctgggtg
gagggcagggctgagcggccggagagccgcaacccggccccgttccggccgccgatgctc
tcgcacccggtggaggagttcgaagacctcgacaaactcgaaccggaggcgttttcggcg
gagtggaaatgggacggcatccgcgtccagctcgcgggcgggcgcgacagccagggccgg
caggtccaaaaagtctactcgcgcaccggcgaggacatctccgccgcgttccccgatctc
gccgaggcgatcaccttcgacggcgccctcgacggcgaattgctgatcctgcgcgaggga
cgcgtccagagcttcaacgtgctccagcaacggctcaaccggaaggcggtgacgggcaag
ctcctggaggagttcccggcccatgtccgcgcctacgacgtgctgtcggccgagggcgag
gacctgcgcccgctgcccttcgccgagcgtcgcccccggttggaggccctcgtgcagcgg
ttggaccacgcccggatcgacctctcgcccgtggtgtcgttcgcgacctgggacgacgtc
gccgcggcgcgcgccgatccggcctccgccggggcgggggccgatgcggacgccatcgag
ggcgtgatgctcaagcggcgcaacagcccctacctgccgggccgtcccaaggggccgtgg
tggaagtggaagcgcgagccctacgtggtcgatgccgtgatgatgtacgcccagcgcggc
cacgggaagcgctcgtccttctactccgactacaccttcggctgctggcgcgagggggcg
gaaggcgaggagttggtgccggtcggcaaggcctatcacggcttcaccgatgccgaactg
caaaagctcgaccgctacgtccgcaaccatacgaccaagcggttcggcccggtgcgcgag
gtcgcctacggccgcgaggccgggctggtgctggagatcgccttcgagggcgtgcagcgc
tcgacccggcacaaatcgggcgtggcgatgcgcttcccccgcgtcagccgcatccgctgg
gacaagccggcggcggaggccgaccgggtcgatgtgctggaacggattctggcgcgcggc
gagcgcgaggtcgcgccgggcgcggcgttggaggcatcggaatga

DBGET integrated database retrieval system