KEGG   Methylobacterium sp. AMS5: Y590_16805Help
Entry
Y590_16805        CDS       T04283                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
meta  Methylobacterium sp. AMS5
Pathway
meta00010  Glycolysis / Gluconeogenesis
meta00620  Pyruvate metabolism
meta01100  Metabolic pathways
meta01110  Biosynthesis of secondary metabolites
meta01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:meta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Y590_16805
   00620 Pyruvate metabolism
    Y590_16805
Enzymes [BR:meta01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Y590_16805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AMB46594
UniProt: A0A0X1SKZ0
LinkDB All DBs
Position
3610618..3612141
Genome map
AA seq 507 aa AA seqDB search
MNKPEFLADAKTKSPFSARYDNFIGGQWVAPVSGRYFENTSPITGKVICEVARSEAQDID
KALDAAHAAKDAWGRTAPAERARILNKIADRMEDNLDLIALAETWDNGKPIRETTAADIP
LAIDHWRYFASCVRAQEGAISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPAL
AAGNCVVLKPAEQTPASILVVMELIGDLLPPGVINVVNGFGLEAGKPLASSPRIAKIAFT
GETTTGRLIMQYASQNLIPVTLELGGKSPNIFFGDVANEDDDFFDKALEGFTMFALNQGE
VCTCPSRALVHESIYDRFIERAIKRVEAITQGSPLDPATMIGAQASSEQLEKILSYVDIG
RQEGAECLTGGARGTREGDLADGFYMQPTVFKGHNKMRIFQEEIFGPVLSVTTFKDDAEA
LSIANDTLYGLGAGVWTRDGTRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRE
THKMMLDHYQQTKNMLVSYSSKKLGFF
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcccgaattcctggcggatgccaagacgaaatcgccgttctcggcgcgctac
gacaacttcatcggcggtcagtgggtcgcgccggtcagcggccgctatttcgagaacacc
tcccccatcaccggcaaggtgatctgcgaggtcgcccgctccgaggcgcaggacatcgac
aaggcgctggacgccgcgcacgccgccaaggatgcctggggccgcaccgcgccggccgag
cgcgcccgcatcctcaacaagatcgccgaccggatggaggacaacctcgatctgatcgcg
ctggccgagacctgggacaacggcaagccgatccgcgagacgaccgccgccgacatcccg
ctcgccatcgaccactggcgctacttcgccagctgcgtccgcgcccaggaaggcgcgatc
tccgagatcgaccacgacacggtggcctaccacttccacgagccgctcggcgtcgtcggc
cagatcatcccgtggaacttcccgatcctgatggccgtgtggaagctcgcccccgcgctc
gcggccggcaactgcgtggtgctcaagcccgccgaacagacccccgcctcgatcctcgtg
gtgatggagctgatcggcgacctgctgccgccgggcgtgatcaacgtcgtcaacggcttc
ggcctggaggccggcaagccgctcgcctcgagcccgcgcatcgccaagatcgccttcacc
ggtgagacgaccaccggccgcctcatcatgcagtacgcctcgcagaacctgatcccggtg
accctggagctgggcggcaagtcgccgaacatcttcttcggggatgtcgccaacgaggac
gacgacttcttcgacaaggcgctcgaaggcttcaccatgttcgccctcaaccagggcgaa
gtctgcacctgcccgagccgcgcgctcgtgcacgagtcgatctacgaccgcttcatcgag
cgcgcgatcaagcgcgtcgaggcgatcacgcagggctcgccgctcgatccggcgacgatg
atcggtgcgcaggcctcctcggagcagctcgagaagatcctcagctacgtcgatatcggc
cgccaggaaggcgccgagtgcctcaccggcggcgcccgcggcacccgcgagggcgatctg
gccgacggcttctacatgcagccgacggtgttcaagggccacaacaagatgcggatcttc
caggaggagatcttcgggcccgtcctctcggtgacgaccttcaaggacgacgcggaggcg
ctctccatcgccaacgacacgctctacggcctcggcgccggcgtgtggacccgcgacgga
acccgcgcctaccgcttcggccgcgccatccaggccggccgcgtctggacgaactgctac
cacgcctacccggcgcatgcggccttcggcggctacaagcagtccggcatcggccgcgag
acccacaagatgatgctcgaccactaccagcagaccaagaacatgctcgtcagctactcc
tcgaagaagctcgggttcttctga

DBGET integrated database retrieval system