KEGG   Methylobacterium sp. AMS5: Y590_17665Help
Entry
Y590_17665        CDS       T04283                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
meta  Methylobacterium sp. AMS5
Pathway
meta00473  D-Alanine metabolism
meta01100  Metabolic pathways
meta01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:meta00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Y590_17665
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Y590_17665
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:meta01011]
    Y590_17665
Enzymes [BR:meta01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Y590_17665
Peptidoglycan biosynthesis and degradation proteins [BR:meta01011]
 Precursor biosynthesis
  Racemase
   Y590_17665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AMB46765
UniProt: A0A0X1SLM7
LinkDB All DBs
Position
complement(3799030..3800172)
Genome map
AA seq 380 aa AA seqDB search
MPALARTAPIASAGPPVPATASAVLTVDLAALAANYCALRAMAARAACAAVVKADAYGLG
IERVAPALARAGCRSFFVAHAEEGLALRRILGPAPGISILHGLPSGTEGECHAHDLTPVL
NDDGQRAAWCALASRLGRRLPAILQIDSGMARFGFSPDEAAACLDTGGFDGLDLRLVMSH
LACADRPDDPANAAQRTVFDAFRTRLPGVPASLAASSGTFLSADFHYDLIRPGAALYGIA
PQAGRPNPMRPVVGLAARVMQVRQVPAGTAVGYGHTARVARDSRLATVAIGYADGFLRSA
SGRGEVWQDGHRLPILGRVSMDSIVIDATDAPPGAVAPGSWIEVVGRARSLDAVADAAGT
IGYEVLTSLGHRFHRHYRDA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgccctcgcccgcaccgctcccatcgcgtccgctggacctcccgtaccggcgacg
gccagcgccgtcctgacggtcgacctcgcggcgctcgccgccaactactgcgccctgcgg
gccatggctgcgcgggcggcgtgcgccgccgttgtcaaggcggatgcctacggtctgggg
atcgaacgcgtcgcccccgccctggcgcgggcgggctgccgctccttcttcgtcgcccat
gccgaggagggcctcgcgttgcgcaggattctcggaccggcccccgggatctcgatcctg
cacggccttccgtccggcaccgagggggagtgccatgcgcacgatctcacgccggtcctg
aacgacgacgggcagcgagccgcctggtgtgccctcgcgtcccggctcggacgacgcctg
ccggcgatcctgcagatcgacagcggcatggcccggttcggcttctccccggacgaggcc
gccgcctgcctcgacacgggcgggttcgacggcctcgacctgcgccttgtgatgagccat
ctcgcctgcgccgaccgaccggacgatccggcgaatgccgcgcagcggacggtgttcgac
gccttccgcacccgcctgcccggggtccctgcgagcctcgcggcctcctccggcacattc
ctgagcgcggacttccattacgatctcatccggccgggagccgccctctacgggatcgcc
ccccaggccgggcgccccaaccccatgcggcccgtcgtcggcctcgcggcgcgcgtgatg
caggtccggcaggtaccggccgggaccgcggtgggctacggccacacggcccgcgtcgcg
cgcgacagccgcttggccacggtggccatcggctatgcggacggcttcctgcgcagcgcc
tcgggccgcggcgaggtctggcaggacggccaccgcctgcccatcctgggccgcgtctcg
atggacagcatcgtgatcgacgcgacggatgccccccccggcgccgtcgccccgggaagc
tggatcgaggtcgtcggccgggcgcgcagcctcgatgccgtggccgacgccgccggcacg
atcgggtacgaggttctcacgagcctcggccatcgcttccaccgccactatcgcgacgcc
tga

DBGET integrated database retrieval system