KEGG   Methylobacterium sp. AMS5: Y590_23920Help
Entry
Y590_23920        CDS       T04283                                 

Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
meta  Methylobacterium sp. AMS5
Pathway
meta00061  Fatty acid biosynthesis
meta00780  Biotin metabolism
meta01100  Metabolic pathways
meta01212  Fatty acid metabolism
Module
meta_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:meta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Y590_23920
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Y590_23920
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:meta01004]
    Y590_23920
Enzymes [BR:meta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Y590_23920
Lipid biosynthesis proteins [BR:meta01004]
 Fatty acid synthase
  Component type
   Y590_23920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AMB48014
UniProt: A0A0X1SQ19
LinkDB All DBs
Position
5202670..5203131
Genome map
AA seq 153 aa AA seqDB search
MSETRELGSADIQKVLELLPHRYPFLMIDRIIEIDRDESCIGIKNVTANEPQFTGHFPGL
PVFPGVLLIEGMAQTAGAICCRHIMNDDLKTKQVFFMTIDKCKFRKPVVPGDQVRFHMTK
MNQRKTMWWFRGEARVDGALVAQAEIGAMLVTE
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagacgcgggagctgggttcggccgatatccagaaagtgctggaactactgccc
caccgctatcccttcctgatgatcgaccgcatcatcgagatcgaccgggacgagagctgc
atcggcatcaagaacgtcacggcgaacgagccgcaatttaccgggcacttccccggcctg
ccggtcttccccggcgtgctgctgatcgaaggcatggcccagaccgcgggcgcgatctgc
tgccgccacatcatgaatgacgacctgaagaccaagcaggtcttcttcatgaccatcgac
aagtgcaagttccgcaagcccgtcgtgcccggtgaccaagtgcgcttccacatgacgaag
atgaaccagcgcaagaccatgtggtggttccgcggcgaggcccgcgtcgacggcgcgctc
gtcgcccaggccgagatcggtgccatgctggtgacggagtga

DBGET integrated database retrieval system