KEGG   Methylobacterium sp. AMS5: Y590_24895Help
Entry
Y590_24895        CDS       T04283                                 

Definition
(GenBank) glutathionine S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
meta  Methylobacterium sp. AMS5
Pathway
meta00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:meta00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Y590_24895
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:meta02000]
    Y590_24895
Enzymes [BR:meta01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Y590_24895
Transporters [BR:meta02000]
 Other Transporters
  Pores ion channels [TC:1]
   Y590_24895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C GST_C_2 GST_C_3 TipAS
Motif
Other DBs
NCBI-ProteinID: AMB48209
UniProt: A0A0Y0IHP4
LinkDB All DBs
Position
5417081..5417725
Genome map
AA seq 214 aa AA seqDB search
MTARTLYYAPGACSLASHIVLEEIGAPYETIRLDLAKGDQRAPEYLAVNERGRVPALYEE
GWVLTENAAILRHLARSHPEAGLLPEDLRGQASADEWMAWLSTGHHIAYAHVRRPERYSA
DEAAFPEIRAKGADTFGDLCTMTEVRLSNGGWALGERYSVVDAYLMVFWVWARGPTIGFD
MPALFPAWTAHARRMAERAAVRAVFAREGLALPA
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccgcaccctctactatgcccccggcgcctgctcgctcgcctcccacatcgtg
ctggaggagatcggcgccccctacgagaccattcgcctcgacctcgccaagggcgaccag
agagcgccggaatacctcgcagtcaacgagcgcggacgcgtaccggccctctatgaggag
ggctgggtgctcaccgagaacgccgcgatcctgcgccacctcgcccgctcccatccggag
gccggcttgctgccggaggatctgcgtgggcaggcgtcggccgacgagtggatggcctgg
ctctcgaccgggcatcacatcgcctatgcccatgtccgccggcccgagcgctacagtgcc
gacgaggccgccttcccggagatccgggcgaagggggccgacaccttcggcgatctctgc
accatgaccgaggtgcggctttccaacggcggctgggcgctcggcgagcgctacagcgtc
gtcgatgcctacctcatggtgttctgggtctgggcccgcggccccacgatcggcttcgat
atgcctgcgctctttccggcctggacggcgcatgcccgccgcatggccgaacgggctgcg
gtgcgtgccgtcttcgcccgcgaggggctggcgctgccggcctga

DBGET integrated database retrieval system