KEGG   Methanosphaera sp. BMS: AW729_05410Help
Entry
AW729_05410       CDS       T05504                                 

Gene name
porA
Definition
(GenBank) pyruvate ferredoxin oxidoreductase
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
metb  Methanosphaera sp. BMS
Pathway
metb00010  Glycolysis / Gluconeogenesis
metb00020  Citrate cycle (TCA cycle)
metb00620  Pyruvate metabolism
metb00640  Propanoate metabolism
metb00650  Butanoate metabolism
metb00680  Methane metabolism
metb00720  Carbon fixation pathways in prokaryotes
metb01100  Metabolic pathways
metb01110  Biosynthesis of secondary metabolites
metb01120  Microbial metabolism in diverse environments
metb01130  Biosynthesis of antibiotics
metb01200  Carbon metabolism
Module
metb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
metb_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:metb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AW729_05410 (porA)
   00020 Citrate cycle (TCA cycle)
    AW729_05410 (porA)
   00620 Pyruvate metabolism
    AW729_05410 (porA)
   00640 Propanoate metabolism
    AW729_05410 (porA)
   00650 Butanoate metabolism
    AW729_05410 (porA)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    AW729_05410 (porA)
   00680 Methane metabolism
    AW729_05410 (porA)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    AW729_05410 (porA)
Enzymes [BR:metb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     AW729_05410 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: AWX32568
UniProt: A0A2Z4L8X3
LinkDB All DBs
Position
complement(1556810..1557949)
Genome map
AA seq 379 aa AA seqDB search
MVVKVISSAEAISEAVKRARPDVIPVYPITPQTKISEKLADYVADGELDAHYIKVESEHS
AMSAAIGASGAGVRVFTATSSQGLAYMHEPVFAAAGMRVPIVMADVNRALSSPINIWNDQ
QDSLAERDAGWIQIYAETGQEAFDTTIQAFKIAENKDVLLPVMVCVDGFILTHTVDPVEL
ITQEDVDEFLPPYVPEHSYLDPKDPMSLGTLADPAHYMEIRYDIEKALQNSLSVIEEVGK
EYGEKFGRTYGLIEEYKSEDAEIILIAMGSLCDTIKDVVDERRENGEKVGLIRVRVYRPF
PKDALKEAVGDAKLAVIDKDVSFSSGGALYLDTKSTVNNDTYNYIVGLGGRDITPKEIDE
IIEKTKNPQNDVEWIGLKE
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggttgttaaagttatttcatcagcagaagcaatatccgaagctgtaaaacgtgcaaga
ccagatgtaattcctgtatacccaattacgccacagacaaaaatatccgaaaaactagcg
gactacgttgcagatggtgaattggatgctcattacattaaagtagaatcagaacacagt
gcaatgagtgcagctataggtgcatcaggtgctggtgtaagagtatttacagcaacttca
agtcagggactggcatacatgcacgaaccagtcttcgcggcagcaggtatgagagttcct
atagtaatggcagatgtaaaccgtgcattgtcatcaccaatcaacatatggaacgatcaa
caggattcattagctgaacgtgacgccggatggatacaaatctatgcagaaaccggacag
gaagcattcgatacaacaatacaggcattcaaaattgccgaaaacaaggatgtactactg
cctgtaatggtatgtgtagacggatttatcctaacacacacagtagaccctgtagaatta
atcacacaggaagatgtggatgaattcctaccaccatacgtacctgaacattcctaccta
gatcctaaagatccaatgagtttaggaacactcgcagatccagctcattacatggaaata
agatatgatatcgaaaaggcactacaaaattcattatcagtaatcgaagaagtgggaaaa
gaatacggagaaaaattcggcagaacatacggtttaatagaagaatacaaatcagaagat
gctgaaattatactcatagcaatgggttcattatgtgacaccataaaggatgtagtcgac
gaacgccgtgaaaatggtgaaaaagtcggtttaatcagagtaagagtatacagaccattc
ccaaaagatgctcttaaggaagctgttggagacgccaaattagcagtaatagacaaagac
gtgtcattcagttcaggtggggcattatacttagatacaaaatcaacagtaaataatgat
acatacaattacatcgtaggattaggtggacgtgacataacacctaaagaaatagatgaa
atcatcgaaaaaaccaaaaatccacaaaacgatgtagaatggattggattaaaggagtaa

DBGET integrated database retrieval system