KEGG   Methanosphaera sp. BMS: AW729_08735Help
Entry
AW729_08735       CDS       T05504                                 

Definition
(GenBank) hypothetical protein
  KO
K08093  3-hexulose-6-phosphate synthase [EC:4.1.2.43]
Organism
metb  Methanosphaera sp. BMS
Pathway
metb00030  Pentose phosphate pathway
metb00680  Methane metabolism
metb01100  Metabolic pathways
metb01120  Microbial metabolism in diverse environments
metb01200  Carbon metabolism
metb01230  Biosynthesis of amino acids
Module
metb_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:metb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AW729_08735
  09102 Energy metabolism
   00680 Methane metabolism
    AW729_08735
Enzymes [BR:metb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     AW729_08735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RraA-like
Motif
Other DBs
NCBI-ProteinID: AWX33166
UniProt: A0A2Z4LAD8
LinkDB All DBs
Position
complement(2361145..2361816)
Genome map
AA seq 223 aa AA seqDB search
MSVNKITPKNILNHGKNKNKITLDNLLDKATTDNVSDAMKKVCGKNGVIRNVKPIDGKSK
IVGKIRTAQTNSSDWGTGIKAIYECEEDEILLIDCSDDETAIWGELASQAAQKHGLQATV
INGASRDTEGIKNLGYPVYSKATMPNAGYALNNGVINERLNIEGNVIVNGDYIVGDSEGV
VVVPKERIDDVLEEVSNIKKFEQKLMAQMNDPDNRMDKILDID
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttaataagattacaccgaagaatattttgaatcatggaaaaaacaaaaacaaa
attactttagataacctacttgataaggccaccacggataatgtttctgatgctatgaaa
aaggtatgtggtaagaatggagttatccggaatgttaagccgattgatggaaaatctaaa
attgtaggaaaaatcagaactgcacagactaattccagtgactggggtactggtatcaag
gcaatatatgaatgtgaggaagatgagatattattgattgattgttctgatgatgaaacg
gccatttggggagaattggcttcacaagctgcacaaaaacatggtcttcaggccactgtc
attaatggggcttcacgtgatactgagggaattaaaaacttgggttatcccgtttattcc
aaagccactatgcctaatgccggttatgcattgaacaatggtgttattaatgaacgtttg
aatatcgagggtaatgtcattgttaatggggattatattgtaggcgatagtgaaggcgtt
gttgttgttcctaaggagagaattgatgatgtcttggaggaggtatccaatattaagaaa
tttgagcagaagcttatggctcaaatgaatgatccggacaatcggatggataagatattg
gatattgactaa

DBGET integrated database retrieval system