KEGG   Methanothermobacter sp. CaT2: MTCT_0857Help
Entry
MTCT_0857         CDS       T04009                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
metc  Methanothermobacter sp. CaT2
Pathway
metc00680  Methane metabolism
metc00720  Carbon fixation pathways in prokaryotes
metc01100  Metabolic pathways
metc01120  Microbial metabolism in diverse environments
metc01200  Carbon metabolism
Module
metc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:metc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MTCT_0857
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MTCT_0857
   00680 Methane metabolism
    MTCT_0857
Enzymes [BR:metc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MTCT_0857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAM70106
UniProt: T2GHS3
LinkDB All DBs
Position
844010..845443
Genome map
AA seq 477 aa AA seqDB search
MSTQHPDNVNPPFFAEEPELGGEDEIREAYYVFSHLGCDEQMWDCEGKEVDNYVVKKLLT
KYQAFFRDHVLGEDLRLTLRVPNPTVERAEAKILLETLESIPRSYDTASLFYGMDAAPVF
EVILPMTSSSSCLNRIHSYYLDFVKGKERLQLADGVTVKEWIGEFRPDEINVIPLFEDHE
GMLNAAKITGEYLDGKDIQEQRVFLARSDPAMNYGMISATLLNRIALSDFRDLEEESGVK
LYPIIGMGSAPFRGNLRPDNVEDVTWEYRGAYTFTVQSSFKYDHEPSDVIRGIKKLRSVK
PGRAAEIERESVLEIISAYCREYRRQVMDLVDIINRVARYVPGRRKRKLHIGLFGYSRSM
GNVSLPRAITFTAALYSLGVPPELLGFNALSSGDLEFIEEVYPGLGRDLHDAARYANPES
PFLSPEVKSSFEEYLEPEYDEGHMKTTEEIIRALRINRTANLQELILEAASQRKFLG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagtacacagcatccagacaacgttaacccgccgttctttgcagaagaacctgaactg
ggtggtgaagacgagataagggaggcatactacgtcttctcacacctgggatgtgacgaa
cagatgtgggactgcgagggcaaggaagtggacaactacgttgtaaagaaactcctcaca
aagtaccaggccttcttcagggaccatgtcctgggtgaggatctgaggctcaccctcagg
gtgcccaaccccacagttgagagggccgaggcaaagatactccttgagacccttgagagc
atacccagatcctatgacaccgcaagcctcttctacgggatggacgcagccccggtcttc
gaggtcatcctacccatgacctcatcaagcagctgcctcaaccggatccacagctactac
ctggactttgtgaagggtaaggagaggctgcagctcgcagatggtgtgaccgtcaaggag
tggataggtgaattccggcccgacgagatcaacgttatccccctcttcgaggaccatgag
gggatgctgaacgccgccaagatcacaggcgagtaccttgatggtaaggatatccaggag
cagagggtcttccttgcaaggtcagaccccgccatgaactacggtatgatatcagccaca
ctcctcaacaggatagccctctcagacttccgggaccttgaggaagagtcaggagttaaa
ctctaccccataataggtatgggctcagctcccttcaggggtaacctccgccccgataat
gtggaggacgttacctgggagtaccgtggcgcctacaccttcactgtccagtcatccttc
aagtacgaccatgaaccatcagatgtcatcaggggcataaagaaactcaggtctgttaaa
ccgggcagggcagctgaaatcgagcgtgaaagtgtcctggagataatttcagcctactgc
agggagtacaggaggcaggtcatggacctcgtggacatcataaacagggttgcgaggtac
gtgcccggcaggaggaagaggaagctccacatcggactcttcggatactccaggagcatg
ggaaacgtttcactcccaagggcaataaccttcacagcggccctctactcgctgggggtt
cccccggagctgctcgggttcaacgcgctatcatcaggtgaccttgaattcattgaggag
gtctacccgggtcttggaagggacctccatgacgctgcaaggtacgccaaccctgaatca
ccattcctcagccctgaggttaaatcatcctttgaggagtaccttgaacctgagtatgat
gagggacacatgaagaccacagaggagatcataagggccctcagaatcaacaggacagcc
aacctccaggagctcatccttgaggctgcaagccagaggaagttcctcggctga

DBGET integrated database retrieval system